Welcome to TradeChina
-
RELATED CATEGORIES:
cheap large mechanical vending machine support credit card payment
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot Milk Vending Machine
$ 298 ~ $ 300
>=50 Piece
Meo Textile Clothing Co.LTD
YN Gym Cold Drink Protein Shake Cheap Vending Machine for Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
candy vending machines
$ 85 ~ $ 90
>=10 piec
Meo Textile Clothing Co.LTD
Cheap Price Lash Vending Machine Wifi Vending Machine
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
JSBS VS1-5000 snack vending machine cheap vending machine mini snack vending machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Factory customize vending machine small mask-vending machine
$ 99 ~ $ 198
>=10 piec
Meo Textile Clothing Co.LTD
vending machine price
$ 100
>=10 Piece
Meo Textile Clothing Co.LTD
Hot Selling Cheap Fresh Automatic Sugar Cane Juice Vending Machine For Sale
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Factory Price Cheap Black Capsules Dispensers Gachapon Vending Machine
$ 98 ~ $ 105
>=1 piec
Meo Textile Clothing Co.LTD
mini vending machine vending machine without screen no screen vending machine on the wall
$ 215
>=1 Set
Meo Textile Clothing Co.LTD
water vending machine manufacturer/direct factory prices of water vending machine
$ 900
>=1 Piece
Meo Textile Clothing Co.LTD
Towel soap wash fluid vending machine with different payment devices remote control platform big touch screen
$ -
>=1 Set
Meo Textile Clothing Co.LTD
[MACATBiue and White With No Top Display Cabinet Gashapon Machine
$ 195 ~ $ 235
>=1 Set
Meo Textile Clothing Co.LTD
Toy vending machine plastic capsules/cupcake vending machine/instant noodle vending machine price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Sing Head Small Vending Machine Steel Universal Technical Parts Coin Dispenser Sale from Korea YELLOW GREEN
$ 57 ~ $ 63
>=50 Set
Meo Textile Clothing Co.LTD
Totem wall mounted cheap wall hang mini vending machine
$ 549.99
>=1 piec
Meo Textile Clothing Co.LTD
Traditional Barrel Single Vending Machine for bulk and commercial Vending Single Stand
$ 28 ~ $ 60
>=10 Set
Meo Textile Clothing Co.LTD
SNBC BVM-RI200 Beauty Vending Machine Cheap Machines Snack And Drinks Cup Noodle Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot drinks 1600W, attractive in price and quality vending machine/coffee dispenser machine/cheap vending machine
$ 200
>=1 Piece
Meo Textile Clothing Co.LTD
Guangzhou Winfo Coin Vending Machine
$ 480 ~ $ 550
>=1 Set
Meo Textile Clothing Co.LTD
self cheap hot food cold coffee vending machine for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Oyade New type vending machine Mask Vending machine
$ 500
>=1 Set
Meo Textile Clothing Co.LTD
Cooled Eggs Condom Automated Drink Vending Machines Manufacturer
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheap custom vending machine coin mechanism mini capsule toy vending machine
$ 73 ~ $ 199
>=1 Piece
Meo Textile Clothing Co.LTD
Cheap Price Snacks Cool Beverages Drinks Refrigerated Vending Machines
$ -
>=1 Set
Meo Textile Clothing Co.LTD
10 cargo road vending machine
$ -
>=25 piec
Meo Textile Clothing Co.LTD
Gumballs mechanical vending machine die cast chrome coated
$ 94.52 ~ $ 99.49
>=1 Piece
Meo Textile Clothing Co.LTD
mask auto vending machines
$ 700 ~ $ 800
>=10 piec
Meo Textile Clothing Co.LTD
Convenience Store Automatic Snack and Drink Combo Advertisement Self-Service Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot Sell Novelty Design Capsule Toy Kid Game Station Vending Machine
$ 120 ~ $ 180
>=20 Piece
Meo Textile Clothing Co.LTD
Food and Beverage Machinery Singpore Hot Fresh Food Bento/ Lunch Vending Machine
$ 850
>=10 Piece
Meo Textile Clothing Co.LTD
Battery operated vending machine Solar energy vending machine
$ 220 ~ $ 350
>=1 Set
Meo Textile Clothing Co.LTD
Cheap Price Gift Box Cosmetics Lipstick Retail Vending Machine for Subway
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
Customized floor standing gift Vending Machine
$ 625 ~ $ 725
>=1 piec
Meo Textile Clothing Co.LTD
Cheap candy vending machine hot sale gumball machine mini vending machine
$ 45 ~ $ 52
>=5 Piece
Meo Textile Clothing Co.LTD
Cheap price NNL-118 gashapon vending machines for sale
$ 100 ~ $ 200
>=10 Piece
Meo Textile Clothing Co.LTD
2021 High quality cheap price stainless steel coffee vending machine from China
$ 10 ~ $ 50
>=500 Piece
Meo Textile Clothing Co.LTD
outdoor tabletop smart coin bill acceptor automatic operated machines bean to cup instant coffee vending machine cheap price
$ 900
>=1 Set
Meo Textile Clothing Co.LTD
Cheap soda drink condom toys food snack noodle vending machine with AI intelligent background
$ -
>=1 piec
Meo Textile Clothing Co.LTD
hot sell automatic snack drink smart cheap combo vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2020 Cheap coin operated small capsule toys gashapon vending machine
$ 170 ~ $ 500
>=1 Unit
Meo Textile Clothing Co.LTD
ZG cheap vending machine small combo snack vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheap Price Surgical Mask Ppe Vending Printing Machine
$ 150 ~ $ 220
>=1 Set
Meo Textile Clothing Co.LTD
Gumball Spiral Vending Machine
$ 120 ~ $ 225
>=1 Piece
Meo Textile Clothing Co.LTD
cheap mini candy toy vending machine
$ 5 ~ $ 12
>=240 Box(es)
Meo Textile Clothing Co.LTD
cheap high quality automatic drink coffee tea vending machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Mask Vending Machine Epidemic prevention n95 surgical mask hand sanitizer Alcohol bottle vending machine for sale cheap
$ 580 ~ $ 800
>=1 Unit
Meo Textile Clothing Co.LTD
Factory Cheap Price 2019 latest Funny Beauty Cosmetics Perfume lipstick vending machine
$ 780
>=1 Set
Meo Textile Clothing Co.LTD
reverse vending machines coin operated alkaline purified water vending machine for sale purified water
$ -
>=2 Unit
Meo Textile Clothing Co.LTD
Related Searches:
atlantiscoffeevendingmachinenewandusedvendingmachinessnacksvendingmachinepricelavazzavendingicevendingmachinebusinessforsaleoldpepsivendingmachinecappuccinovendingmachinemilkvendingmachinepricedrinkmachinenearmelypcgumballmachinehotmealvendingmachinenorthwesternvendingmachinesrunningavendingmachinebusinessmechanicalvendingmachinepizzafornovendingmachinevendingstorenectacoffeemachinepricevendingmachineplacementpopvendingmachineforsalegumvendingmachineusedsodavendingmachinesforsalenearmesodacanmachineintelligentvendingmachinesmartvendingsolutionsfrozenvendingmachinebestcoffeevendingmachinesfrozenfoodvendingmachinesvendingshopcandyvendingmachinebusinessbestsellingvendingmachinecandy