Welcome to TradeChina
-
RELATED CATEGORIES:
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinder
$ 7.7
>=1000 Piece
Meo Textile Clothing Co.LTD
Breath Alcohol Tester Vending Machine
$ 38 ~ $ 338
>=50 Piece
Meo Textile Clothing Co.LTD
RO Water Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Raspberry Pi Wiegand QR Bar Code Reader Module Vending Machine Barcode Scanner Module
$ 62 ~ $ 75
>=2 piec
Meo Textile Clothing Co.LTD
Eletronic locking system 80mm thermal receipt panel printer for vending machine
$ 130 ~ $ 138
>=10 piec
Meo Textile Clothing Co.LTD
Customize CNC Machining Popcorn Coin Part Coffee Vending Machine Spare Parts
$ 90
>=10 piec
Meo Textile Clothing Co.LTD
Wholesale Hot Sale Custom Multifunctional Medical Mask Vending Machine
$ 150 ~ $ 300
>=1 piec
Meo Textile Clothing Co.LTD
Zhongda e-cigarette e cig Vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Cup Dispenser Coffee Vending Machine for Foods and Drinks
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheapest easy use commercial coffee vending machine
$ 290 ~ $ 460
>=10 piec
Meo Textile Clothing Co.LTD
TCN cup noodle vending machine cafe coffee vending machine for sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Zoomgu China Supplier Best Choice Customized Coffee Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Small Machine Make Money at Home Coffee Vending Machine Cash Card Payment System
$ 650 ~ $ 780
>=1 piec
Meo Textile Clothing Co.LTD
AFEN europea style auto cup coffee espresso coffee cafe vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coin Operated 302TR Turkish Coffee Vending Instant Cafe Machine
$ 580 ~ $ 720
>=1 Piece
Meo Textile Clothing Co.LTD
USA CBD Cafe Product Pizza Vending Machine Heating Food Auto Bagging Automated Self Vending Machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
coin operate automatic coffee capsule vending machine/cafe vending machine with RFID card reader
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2019 New Business Cheap Small WiFi Coffee Beans Vending Machine Maquina Expendedora De Cafe
$ 372 ~ $ 389
>=1 Unit
Meo Textile Clothing Co.LTD
Best Selling Coffee Dispenser cafe vending machine WF1-303A
$ 160 ~ $ 200
>=1 piec
Meo Textile Clothing Co.LTD
Cafe Vending Machine
$ -
>=10 Set
Meo Textile Clothing Co.LTD
Macas Bean to cup coffee machine with big touch screen coffee shop use
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Factory Price Coffee Robot Milktea&Cafe Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
mindi maquinas expendedoras de cafe beer vending gashapon machine
$ 140 ~ $ 149
>=1 piec
Meo Textile Clothing Co.LTD
Built In Best Filter Cafe Tea Coffee Vending Machine
$ 617.5 ~ $ 684
>=1 Set
Meo Textile Clothing Co.LTD
More Than 20 Flavours Standing Freshly Ground Coffee Orange Juice Vending Machine Machine a cafe fraichement moulue
$ -
>=2 Set
Meo Textile Clothing Co.LTD
2019 Jetinno touch screen cafe vending machine automatic le vending
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Wenzhou self vending hot cafe machine
$ 330 ~ $ 450
>=1 Set
Meo Textile Clothing Co.LTD
OneCapsule cafe coffee day vending machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Hot beverage vending machine - Coin Mechanism
$ 198 ~ $ 200
>=50 Piece
Meo Textile Clothing Co.LTD
orange cans automatic netwoks products hot food vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Rokia Lanche / Bebida Fria E Cafe Maquina De Venda Better Quality With Cup Dispenser Coffee Bean Vending Machine From China
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN music vending machines are installed in bars/cafes/restaurants/entertainment establishments
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
2021 professional commercial coffee machine fully automatic
$ -
>=6 Set
Meo Textile Clothing Co.LTD
High quality automatic smart outdoor soft ice cream coin vending machines for cafe shop in price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
High Quality Transation Terminal Vending Touchscreen Bitcoin Atm Machine
$ 800
>=1 Piece
Meo Textile Clothing Co.LTD
Drugs High Tech Snack Mini Motor Grid Drinks&Snacks Combo Wifi Coin Vending Machine Custom Sandwiches Beer Cafe For Toys
$ 20 ~ $ 70
>=500 Set
Meo Textile Clothing Co.LTD
Panic Buying Vending Machine Cafe Self-Service Vending Machine
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
2019 Coin Operated Instant Tea/Coffee/Coffe/Cafe Vending Machine for Sale
$ 170 ~ $ 300
>=100 Piece
Meo Textile Clothing Co.LTD
chicles de bola maquina de agua maquinas expendedoras de maquillajes/maquina expendedora de cafe/maquina expendedora
$ -
>=1 piec
Meo Textile Clothing Co.LTD
5 hot /cold drinks Coffee/hot chocolate/Cafe Vending Machine Professional Instant Coffee Vending machine WF1-505A
$ 240 ~ $ 320
>=1 Piece
Meo Textile Clothing Co.LTD
Commercial Nescaf Cafe Vending Machine Hot and Cold Drink Dispenser 4 Hot and 4 Cold Options Pump Water Carbon Steel
$ 650 ~ $ 720
>=1 Unit
Meo Textile Clothing Co.LTD
Coffee/milk/Cafe Vending Machine Professional Instant Coffee Vending machine for Sale WF1-306B
$ 300 ~ $ 400
>=1 piec
Meo Textile Clothing Co.LTD
ZG Oem/odm Combo Snack Cafe Vending Espresso Commercial Chocolate Coffee Vendor Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
ZG Oem/odm Combo Snack Machines Sales Coffee/coffee/cafe Hot Selling Espresso Coffee Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN Combo custom cafe coffee vending machine price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Full Automatically Cafe Vending Machine
$ -
>=10 Set
Meo Textile Clothing Co.LTD
Yinong Cafe/Coffe Vending Machine Made in China GBD103
$ 220 ~ $ 300
>=1 Unit
Meo Textile Clothing Co.LTD
AFEN custom made cheap coffee machine wholesale coffee vending machine cafe
$ -
>=1 Set
Meo Textile Clothing Co.LTD
YN Protein Shake Powder Drink Coffee Vending Machine a cafe monnayeur
$ -
>=1 Set
Meo Textile Clothing Co.LTD
SC-7902 High quality good price tea cafe vending machine for small office
$ 1 ~ $ 170
>=50 Piece
Meo Textile Clothing Co.LTD
Related Searches:
snacksvendingmachinepriceoldpepsivendingmachine1950scokemachinelaysvendingmachineantiquecocacolamachinecappuccinovendingmachinesodamachinecostkoolericemachineforsaleeyelashvendingmachinepopvendingmachineforsalevendingshopretrocokemachinevendingmachineshopminipopmachinegachavendingmachinegiftcardvendingmachinenectacoffeemachinepricefrozenvendingmachinevendingstorevendingsystemsweetdispensermachineskittlesvendingmachineforsalebeervendingmachineforsalecoffeevendomachineforsalesodacanmachinevendomachineforsalesmallsnackvendingmachinevendingmachinelocatorsbestsellingvendingmachinecandymilkvendingmachineprice