Welcome to TradeChina
-
RELATED CATEGORIES:
2020 Hot sale mini bulk bubble gum plastic candy dispenser
$ 20 ~ $ 59
>=1 Piece
Meo Electronic Technology Co.LTD
M2M Wireless GSM Date Receiver ATM POS System Datalogger GSM 3G Modem Bulk sms machine
$ 53 ~ $ 58
>=1 Set
Meo Advertising Co.LTD
Toy Vending Machine/vibrating screen/washing machine Super Rubber Bouncy Ball Wholesale
$ 0.2 ~ $ 1
>=5000 Piece
Meo Food Co., Ltd.
Bitcoin ATM Cash Payment Kiosk Ticket Vending Machine
$ 900
>=1 Set
Meo Textile Clothing Co.LTD
Very cute cheap promotional DIY plastic capsule toy vending machine
$ 0.01 ~ $ 0.02
>=5000 Piece
Meo Food Co., Ltd.
Special promotion solid rubber bouncy ball for children vending machine
$ 0.04 ~ $ 0.2
>=2500 Piece
Meo Food Co., Ltd.
Wholesale Bulk Vending Machine clear toy Capsule
$ 0.02 ~ $ 0.11
>=10000 Piece
Meo Food Co., Ltd.
Halal 1KG Instant Fruit Tea Strawberry Tea Bulk for Vending
$ 3.5 ~ $ 6.5
>=80 Kilogram
Meo Textile Clothing Co.LTD
Bulk Plastic Egg Capsule Toys child surprised toy For Egg Vending Machine
$ 0.06 ~ $ 0.12
>=2000 piec
Meo Food Co., Ltd.
8oz 12oz 16oz bulk one time use vending machine paper cup
$ 0.02 ~ $ 0.04
>=10000 piec
Meo household Co.LTD
Colorful Mixed High Bouncing Balls Bulk Rubber Bouncy Ball For Vending Machine
$ 0.34 ~ $ 0.43
>=1000 piec
Meo Food Co., Ltd.
game vending machine 21.5'' / 22'' LCD monitor
$ 70 ~ $ 130
>=100 Set
Meo Advertising Co.LTD
Hot Sale Toys Twisting Ball Mini Different Cheap Bulk Vending Machine Plastic Egg Capsule Toy
$ 0.13 ~ $ 0.2
>=10 piec
Meo Food Co., Ltd.
Very popular china bulk vending machines IC card coin paper money to get pure drinking water in 24hr
$ -
>=1 Set
Meo Textile Clothing Co.LTD
1" Toy filled vending capsules Bulk mix prizes vintage toys
$ 0.18 ~ $ 0.2
>=500 piec
Meo Food Co., Ltd.
simple construct and light weight small seven shape popcorn puffing and bulking machine (skype:wendyzf1 )
$ 80 ~ $ 200
>=1 Set
Meo Textile Clothing Co.LTD
ZL69 Hot Selling Cheap Bulk Capsule Toys For Vending Machine Small Plastic Capsule Toys
$ 0.13 ~ $ 0.15
>=2000 piec
Meo Food Co., Ltd.
27mm 32mm 45mm Bulk Vending Machine Colorful Solid High Rubber Bouncy Ball
$ 0.01 ~ $ 0.04
>=1000 Piece
Meo Food Co., Ltd.
Hot Selling Small Animal Gashapon Capsule Toys for Vending Machine
$ 0.08 ~ $ 0.13
>=5000 Piece
Meo Food Co., Ltd.
Bulk Plastic twisting mini 25-65mm bouncing ball/ capsule toy/soft animals surprise egg gumball
$ 0.09 ~ $ 0.15
>=1000 Set
Meo Food Co., Ltd.
Pull Back Vehicle Promotional PVC Car For Vending Machine Capsule Toys
$ 0.04 ~ $ 0.05
>=3000 piec
Meo Food Co., Ltd.
Bulk Gumball Vending Machine Crispy Bubble Gum
$ 0.01 ~ $ 0.05
>=1000000 Piece
Meo Auto Parts Co.LTD
china cheap 27mm bouncy balls bulk bouncing ball Toy ball
$ 0.05 ~ $ 0.07
>=100 piec
Meo Food Co., Ltd.
7 oz 230 gsm white paper +18 gsm single wall pe coated paper cups for vending machines hot drinks
$ 0.01 ~ $ 0.05
>=40000 Piece
Meo household Co.LTD
Wholesale mixed color 27mm 32mm 45mm bouncy balls for vending machine
$ 0.09 ~ $ 0.15
>=500 Piece
Meo Food Co., Ltd.
Vending machine disposable single wall paper cups
$ 0.01
>=4000000 Piece
Meo household Co.LTD
Best Price High Quality Mobile Food Truck For Vending Factory Direct Sale
$ -
>=1 Set
Meo Textile Clothing Co.LTD
27mm, 1" Rubber Bouncy Ball Collection- Perfect for Gumball Machine or Bulk Treasure Box 100pc/bag
$ 0.04 ~ $ 0.1
>=1000 Set
Homelife
KMY Cash&Coin Deposit Kiosk Machine Bulk Accepting
$ 1
>=1 Unit
Meo Textile Clothing Co.LTD
USA Unique taste Crunchy Chickpeas mini vending machine snack
$ 1.7
>=1500 Pound
Meo Auto Parts Co.LTD
Bulk Sale D28mm 12v 100rpm 5400rpm micro electric dc planetary steel gear motor for machine design
$ 10.5 ~ $ 15
>=120 piec
Meo Textile Clothing Co.LTD
bulk vending toy capsule balls vending machine plastic capsule
$ 0.04 ~ $ 0.3
>=1 Piece
Meo Food Co., Ltd.
Vending Machine Toys , Cheap High Bouncing Ball Wholesale
$ 0.08 ~ $ 0.5
>=5000 Piece
Meo Food Co., Ltd.
Luxury Black Shoe Boxes Candle Packaging Boxes Box Gift for Make Up Baphomet Rock Crystal Jewelry Shadow Wholesale Vending
$ 3.53
>=2 Piece
Mio toy Trading Co., Ltd
coil spring for vending machine
$ 0.05 ~ $ 0.15
>=10000 Piece
Meo Textile Clothing Co.LTD
assemble bulk small vending toys elf horses for empty capsule
$ 250 ~ $ 500
>=1 Carton(s)
Meo Food Co., Ltd.
Bulk Plastic Animal Toys For Vending Machines mini toys for capsules
$ 0.1 ~ $ 1
>=100000 Piece
Meo Food Co., Ltd.
Easter Activities Egg Toy For Vending Machine
$ 0.08 ~ $ 0.1
>=10000 Piece
Meo Food Co., Ltd.
Factory Direct High Quality custom design pink lashes wigs vending bundles and clouser bundle hair atand
$ 15.9
>=1 Piece
Meo Food Co., Ltd.
Vending machine hair vatika egg protein mask. dabur dabur. vatika. vicco. india valencia rose
$ 41.9 ~ $ 218.4
>=10 Piece
Meo Food Co., Ltd.
Small Alien Character Figure Capsule Toys For Vending Machine
$ 0.02 ~ $ 0.04
>=10000 piec
Meo Food Co., Ltd.
Cheap Kids vending Machine Toys Hotsale Rubber Basketball Bounce Handball
$ 0.33 ~ $ 0.39
>=1000 piec
Meo Food Co., Ltd.
Wholesale 27mm 32mm 45mm Bulk Vending Machine Rubber Bouncing Balls
$ 0.02 ~ $ 0.36
>=2000 Piece
Meo Food Co., Ltd.
Toy Plastic Capsule for Vending Machines/Empty Capsules/For Shopping Mall
$ 0.03 ~ $ 2.3
>=100 piec
Meo Food Co., Ltd.
Wholesale 27mm Printed Bouncy Ball for Vending Machine
$ 0.04 ~ $ 0.06
>=1000 piec
Meo Food Co., Ltd.
Customized Zhutong Three Containers Candy Vending Machine On Stand Three Head Chewing Gum Vending Machine with Stand
$ 85 ~ $ 125
>=1 piec
Meo Textile Clothing Co.LTD
NEW BUIK CANDY VENDING MACHINE
$ 44
>=40 piec
Meo Textile Clothing Co.LTD
ZG Oem/odm Convenience Store Automatic Cake Noodles Daily Food China Bulk Bread Cup Noodle Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
AFEN automatic lift system smooth delivery low temperature cupcake vendor bulk cup cake vending machines
$ -
>=1 Set
Meo Textile Clothing Co.LTD
mindi maquinas bulk used beverage vending machines
$ 90 ~ $ 98
>=1 piec
Meo Textile Clothing Co.LTD
Related Searches:
icevendingmachinebusinesscolavendingmachinevendomachineforsaleusedsodavendingmachinesforsalenearmelocalvendingmachinecompaniestopvendingmachinecompaniesnewandusedvendingmachinescoffeevendomachineforsaleeyelashvendingmachinewatervendingmeivendingmachinefrozenfoodvendingmachinesusedcombovendingmachinescoffeepremixforvendingmachineoldpepsivendingmachinesmallsnackvendingmachinesilentsalesforcegumballmachine1950scokemachinevintagevendingpepsimachinessodamachinecostbestcoffeevendingmachinesbusinesseslookingforvendingmachinessolarpoweredvendingmachineusedcokemachinevendingsupplydrinkvendingmachinenearmeminipopmachinecoffeedaymachinecostcandymachinetoy