Welcome to TradeChina
-
LED light mosquito pest trap pest repller pest defender
$ 3.36 ~ $ 4.83
>=130 piec
Meo Food Co., Ltd.
Mosquito Killer Lamp Chemical-Free Fly Bug Dispeller Light USB Powered Mosquito Repellent for Outdoor Indoor Home Pest Repeller
$ 0.5 ~ $ 3.99
>=50 Pack
Meo Food Co., Ltd.
uv led mosquito killer lamp anti-mosquito lighting dual-use household mosquito lamp holder E27 9W
$ 1.55 ~ $ 2.2
>=2 piec
Meo Food Co., Ltd.
Mosquito Killer Led Light Bulb E27 Mosquito Repellent Lamp 9W 12W 15W
$ 1
>=100 Piece
Meo Food Co., Ltd.
Solar mosquito killer lamp solar mosquito killer
$ 10 ~ $ 15
>=200 piec
Meo Food Co., Ltd.
2019 USB Photocatalyst Mosquito Killer lamp Mosquito Repellent Bug Insect Trap Light UV Light Killing Trap Lamp Fly Repeller
$ 2.98 ~ $ 3.58
>=2 piec
Meo Food Co., Ltd.
LM Wholesale Lamp Mosquito Repeller/Led Anti-mosquito Lamp/Mosquito Killer Trap Lamp
$ 1.45 ~ $ 2.65
>=100 Set
Meo Food Co., Ltd.
Home Innovations Electronic Bug Zapper with UV Light LED Mosquito Killer Insect Trap
$ 2.5
>=30 Piece
Meo Food Co., Ltd.
2020 Indoor Home Quiet LED Killing Bug Zapper Portable USB Electric Anti Mosquito Killer Lamp Insect Mosquito Trap Lamp
$ 1.25 ~ $ 2.5
>=50 Piece
Meo Food Co., Ltd.
Chemical Free USB Powered UV LED Light Electrical Mosquito Killer Fly Bug Zapper Attract Mosquito Lamp Killer Black
$ 0.98 ~ $ 1.9
>=300 piec
Meo Food Co., Ltd.
UV lamp commercial electric fly trap mosquito killer, mosquito catcher electronic UV LED mosquito killer lamp insect trap
$ 1.29 ~ $ 2.1
>=60 piec
Meo Food Co., Ltd.
Factory Directly Sales electric mosquito killer anti mosquito repellent ultrasonic electronic pest repeller
$ 1.53 ~ $ 2.03
>=10 Bag(s)
Meo Food Co., Ltd.
Multifunctional Mini USB Rechargeable Electric Fly Killer Solar Powered Mosquito Bug Zapper
$ 6 ~ $ 7.5
>=1000 Piece
Meo Food Co., Ltd.
7indoor commercial portable insect inhaler zapper trap pest repeller tueur de moustiques UV lamp tube LED mosquito killer lamp
$ 3.1 ~ $ 3.72
>=500 Piece
Meo Food Co., Ltd.
Updates USB Electric Mosquito Machine 365NM UV LED Light Insect Trap Mosquito Killer Lamp
$ 2.46 ~ $ 2.92
>=2 piec
Meo Food Co., Ltd.
110V 240V Light Trap Moth Fly Wasp Bug Insect Light Killing Pest Zapper Electric Mosquito Killer Lamp
$ 2.7 ~ $ 2.8
>=50 piec
Meo Food Co., Ltd.
IP68 outdoor waterproof mosquito trap with attractant, co2 and heat element garden animal house mosquito killer lamp
$ 26.5 ~ $ 30
>=2 piec
Meo Food Co., Ltd.
2020 Summer USB Powered mosquito insect killer fan lamp indoor bug zapper electric insect mosquito killer
$ 1.59 ~ $ 2.19
>=50 piec
Meo Food Co., Ltd.
amazon top seller Powerful Electric LED Bug Zapper Mosquito Insect Killer, electric mosquito killers
$ 1.6 ~ $ 2.7
>=1000 Piece
Meo Food Co., Ltd.
China Mosquito Killer Repellent Trap Lamp Usb LED Lighting Bulb Pest Control Bug Zappers Lights Moskiller
$ 1.02 ~ $ 1.49
>=60 Piece
Meo Food Co., Ltd.
Bway Waterproof Bug Zapper Outdoor 3 in 1 Camping Light Moquito Zapper Killer Lamp
$ 9.65 ~ $ 11.03
>=100 piec
Meo Food Co., Ltd.
High Effective Pest Control Aerosol Insecticide Spray Mosquito Killer
$ 19 ~ $ 37
>=800 Carton(s)
Meo Food Co., Ltd.
3000V electronic mosquito killer UV Lamp USB 1200mAh Rechargeable Bug Zapper Summer Fly Swatter Trap Home Bug Insect Racket
$ 3.5 ~ $ 5.9
>=200 piec
Meo Food Co., Ltd.
Strong ABS UV Ultraviolet Bug Killer in 365NM Blue Light Electric High Voltage Mosquito Killer Lamp
$ 7.72 ~ $ 11.1
>=1000 Piece
Meo Food Co., Ltd.
2020 New Arrivals Electric Usb Powered Charge Outdoor Camping Uvc Lure Led Trap Anti Mosquito Killer Lamp
$ 6 ~ $ 11.5
>=2 piec
Meo Food Co., Ltd.
Electric Mosquito Killer with Trap Lamp, Chemical-Free USB Powered UV LED Light Photocatalyst Fly Bug Dispeller with Suction Fan
$ 2.5 ~ $ 3.5
>=1 Set
Meo Food Co., Ltd.
Hot Selling Product Light-Emitting Electric Bug Zapper Insect Killer Flying Insect Trap for Indoor Mata Mosquito lamp
$ 5 ~ $ 6.3
>=50 piec
Meo Food Co., Ltd.
Electric Bug Zapper Pest Repeller Control Traps Eliminator Catcher Lure Led Uv Mosquito Killer Lamp
$ 15.6 ~ $ 18
>=2 piec
Meo Food Co., Ltd.
USB rechargeable photocatalyst mosquito pest lamp/USB mosquito lamp electric shock/UV LED Electronic Mosquito Killer zapper
$ 3 ~ $ 6
>=100 Piece
Meo Food Co., Ltd.
Amazon hotsale 2 in 1 Usb Electric Mosquito Killer Lamp Swatter Racket Led Llight Attract
$ 7.6 ~ $ 8.5
>=2 piec
Meo Food Co., Ltd.
UV Light bug zapper electric flying zapper portable standing or hanging electric mosquito killer for Indoor Use
$ 2.1 ~ $ 2.5
>=200 piec
Meo Food Co., Ltd.
Insecticide Insect Killer Spray
$ 0.51 ~ $ 0.56
>=1000 piec
Meo Food Co., Ltd.
Multi-function USB electronic mosquito killer lamp Outdoor waterproof camping light USB charging Insect repellent mosquito trap
$ 4.75 ~ $ 5.95
>=10 piec
Meo Food Co., Ltd.
Bug - Bite Suction Tool, Bee Wasp Stings Bite Relief
$ 1 ~ $ 3
>=1 Set
Meo Food Co., Ltd.
2020 New USB Chemical-Free Powered Electric Mosquito Killer with UV LED Light Photocatalyst Trap Lamp and Suction Fan
$ 2.25 ~ $ 4.5
>=1 Set
Meo Food Co., Ltd.
USAMS NEW design household Electric Mosquito Swatter insect bat fly killers
$ 6.15 ~ $ 7.12
>=3 piec
Meo Food Co., Ltd.
Thiamethoxam10% Tricosene0.05% WG for house fly killer
$ 3 ~ $ 6.55
>=500 Kilogram
Meo Food Co., Ltd.
home appliances suspensibility ultraviolet Bug zapper lamp kill insects powerful mosquito killer lamp
$ 4.8 ~ $ 5.2
>=1000 piec
Meo Food Co., Ltd.
2021 Amazon Mosquito Killer lamp Trap Indoor Bug Zapper Electric Insect Killer Fly Pests Killer Lamp with plug in
$ 3.48 ~ $ 3.68
>=10 piec
Meo Food Co., Ltd.
Solar Powered UV LED Bug Zapper & Lantern - Insect Killer Lamp
$ 12.59 ~ $ 15.57
>=100 Set
Meo Food Co., Ltd.
2020 New Insect Repeller Repellent Catalytic Attracts UV LED Electronic USB Powered Mosquito Killer Lamp
$ 1.82 ~ $ 2
>=50 piec
Meo Food Co., Ltd.
Household pest control cockroach killer bait station
$ 11.5
>=500 Unit
Meo Food Co., Ltd.
Electronic usb photocatlyst led light mosquito killer lamp UV light fly bug insect dispeller
$ 1.78 ~ $ 2.5
>=180 piec
Meo Food Co., Ltd.
Mosquito Fly Bug Insect Trap Night Lamp Killer V-01 LED Mosquito Trap CO2
$ 5 ~ $ 15
>=1320 Piece
Meo Food Co., Ltd.
2020 new trap electronic indoor outdoor led anti-mosquito killer lamp
$ 1.5 ~ $ 2.9
>=2 piec
Meo Food Co., Ltd.
Laudtec New-tech Indoor Insect Trap Led Mosquito Killer Electric Mosquito killer Machine for Kids and Mother
$ 5.3 ~ $ 5.5
>=40 piec
Meo Food Co., Ltd.
00703101 Long Size Mosquito Lamp Bug Zapper Killer New Design Mosquito Killer Lamp
$ 5 ~ $ 6
>=500 Piece
Meo Food Co., Ltd.
Summer explosion of indoor electronic safe use of low-voltage mosquito killer
$ 2 ~ $ 4.5
>=1000 piec
Meo Food Co., Ltd.
Newest home appliance eco-friendly bug killer mosquito light trap catcher
$ 8.5
>=1000 Piece
Meo Food Co., Ltd.
Rechargeable mosquito swatter bug zapper
$ 1.8 ~ $ 2.4
>=1000 piec
Meo Food Co., Ltd.
Related Searches:
topratedbugzapperelectronicwaspkillerflycatcherracketcommercialinsectkillerthebestbugzapperpestkillerlampeluctoflyswatterbestsolarpoweredbugzapperpluginflyzapperportableinsectzapperbesthandheldbugzappersolarbugzappersolarbugzapperlanternuvzapperbestbuybugzappergnatbugzappercarbondioxidemosquitozapperflyandmosquitozapperbugzapperproportablemosquitozapperfruitflyzapperbugzapperwandamazonelectricflyswatterbugzappermosquitokillerlampbugzapperswatterelectricflyswatteraustraliazapplightbugzappernzcheapbugzapperbestsolarbugzapper