Welcome to TradeChina
-
factory price human hair toupee for women virgin european human hair toppers blonde balayage color top hair piece
$ 59 ~ $ 300
>=1 Piece
Meo Food Co., Ltd.
613 Blonde Virgin Human Hair,613 Cuticle Aligned Hair Bundles With Frontal,Blonde Virgin Human Hair 613 Bundles With Closure
$ 22.5 ~ $ 78.6
>=1 Piece
Meo Food Co., Ltd.
2014 new densign blonde hair lace top closure piece
$ 30 ~ $ 100
>=1 Piece
Meo Food Co., Ltd.
Color 27 Honey Blonde Brazilian Straight Hair 100% Human Hair Bundles 10-26 inch remy hair weft
$ 12.9 ~ $ 60.87
>=1 Bag(s)
Meo Food Co., Ltd.
Amazon hot sale 2021 summer ruffle casual v neck blouse designs tops woman 1 piece
$ 7 ~ $ 8.6
>=4 Piece
Meo Electronic Technology Co.LTD
Luxury hair best quality blonde hair 613 one single donor cuticle aligned bundles
$ 33.8 ~ $ 101.4
>=1 Piece
Meo Food Co., Ltd.
Morein 100% virgin human hair brazilian 613 blond 3 bundles with frontal hair extension
$ 10 ~ $ 70
>=1 Piece
Meo Food Co., Ltd.
[TOP] Human hair highest quality Factory Wholesale price double drawn virgin hair soft touch holding free
$ 111 ~ $ 603
>=1 Kilogram
Meo Food Co., Ltd.
2020 Wholesale Brazilian 100% Remy Human Hair Extension Straight Halo Hair Piece Top Quality Ombre Halo Hair Extensions
$ 13.96 ~ $ 91.68
>=1 Piece
Meo Food Co., Ltd.
Top grade ponytails hair extensions holder cheveux humains ponytail cheveux extensions clip in ponytail hair pieces
$ 10 ~ $ 20
>=1 Parcel
Meo Food Co., Ltd.
10A Top quality #27 #613 closure hair pieces,supply full cuticle 7x7 u part lace closure,virgin honey lace closure blonde
$ 15 ~ $ 30
>=1 Piece
Meo Food Co., Ltd.
wholesale natural straight virgin human hair extensions blonde color 613 swiss lace frontal
$ 38 ~ $ 148
>=1 Piece
Meo Food Co., Ltd.
Wholesale Price Vietnamese Human Hair Top Quality Blonde Closure and Frontal Hair
$ 40 ~ $ 42
>=3 Piece
Meo Food Co., Ltd.
613 Blonde Color Deep Wave Remy Human Hair Weft Extensions Weave
$ 26 ~ $ 73
>=1 Piece
Meo Food Co., Ltd.
No tangle No shedding human hair closure pieces Easy to dye brazilian hair closure,loose wave closure,human hair with closure
$ 18.6 ~ $ 32.8
>=1 piec
Meo Food Co., Ltd.
Wholesale 613 Cuticle Aligned Virgin Hair,Russian Blonde Virgin Human Hair Bundles With Closure Free Sample Human Hair Extension
$ 14
>=1 piec
Meo Food Co., Ltd.
Large Stock Top Quality Virgin Hair 100% Remy Human Double Drawn Tape Hair Extensions
$ 1.1 ~ $ 5.78
>=40 Piece
Meo Food Co., Ltd.
Brazilian human hair weave bundles closure,human front lace closure hair piece,brazilian virgin hair 3 bundles with lace closure
$ 16.39
>=1 piec
Meo Food Co., Ltd.
100%brazilian virgin blonde color russian hair top HD lace closure hair piece for white women
$ 9.9 ~ $ 69
>=1 Piece
Meo Food Co., Ltd.
NEW Beautiful color 613 blond top quality remy russian hair crown closure
$ 9 ~ $ 65
>=1 Piece
Meo Food Co., Ltd.
FDshine Mongolian Afro Kinky Curly Clip-in Top Closure Ponytail Hair Piece Tight Curl Real Human Hair
$ 20 ~ $ 60
>=1 Piece
Meo Food Co., Ltd.
HOT top grade blonde In 4x4 ombre blonde hair closure piece Brazilian Hair Silk Base Lace Frontal Closure
$ 8.23 ~ $ 65.36
>=1 Piece
Meo Food Co., Ltd.
Top quality factory price human hair blonde feather line hair extensions pieces
$ 55 ~ $ 65
>=1 piec
Meo Food Co., Ltd.
26 28 30 Inch Raw Virgin Natural 613 Blonde Hair Bundles With Lace Frontal Closure,Best 100 Percent Pure Chinese Hair Bundles
$ 12.56 ~ $ 68.89
>=1 Piece
Meo Food Co., Ltd.
wholesale brazilian 10a grade double drawn vietnamese straight mink raw virgin 613 human blonde hair bundles with closure vendor
$ 25 ~ $ 66
>=2 Piece
Meo Food Co., Ltd.
KBL china wholesale extensions hair,natural blonde freetress human hair extensions,remy brazilian human hair extension
$ 10 ~ $ 50
>=1 Piece
Meo Food Co., Ltd.
Top quality 100% 7A European remy 20-32inches hand tied skin weft hair extensions color tape hair extension Italian glue tapes
$ 150 ~ $ 500
>=1 Kilogram
Meo Food Co., Ltd.
KBL 613 straight hair bundles with closure/frontal,frontal raw hair top silk lace closure 13*5,blonde lace frontal hair closure
$ 49 ~ $ 69
>=1 Pack
Meo Food Co., Ltd.
Factory Top Grade Quality Double Drawn Cuticle Aligned Blonde 60# Hair Bulk
$ 20 ~ $ 60
>=1 Piece
Meo Food Co., Ltd.
Large Stock Top Quality tape hair extensions 100% blonde remy russian human hair tape in hair extension
$ 0.25 ~ $ 0.65
>=40 piec
Meo Food Co., Ltd.
Wholesale 613 Cuticle Aligned Virgin Hair,Russian Blonde Virgin Human Hair Bundle,40 Inch Blonde Brazilian Human Hair Extension
$ 13.8 ~ $ 17.28
>=1 piec
Meo Food Co., Ltd.
Top Quality 100% virgin human Hair Bundles Body Wave Brazilian Hair 10A 613 Blonde Hair
$ 5 ~ $ 70
>=2 Piece
Meo Food Co., Ltd.
Wholesale Double Drawn Unprocessed Raw Virgin Cuticle Aligned Hair Vendors,Top Grade Remy Indian Hair 100% Human Hair In Bulk
$ 99.99 ~ $ 571.99
>=1 Set
Meo Food Co., Ltd.
Top selling blonde virgin human hair 613 bundles,russian human hair extension blonde 613,brazilian virgin human 613 blonde hair
$ 39.12 ~ $ 284.82
>=1 Bag(s)
Meo Food Co., Ltd.
Free ship wholesale 12a 100% unprocessed hair extension cuticle aligned raw weaves brazilian virgin remy human hair bundles
$ 9 ~ $ 13.5
>=2 Pack
Meo Food Co., Ltd.
Free shipping discount price wicks blonde Body wave 613 human hair extension blonde hair bundles for wholesale
$ 19 ~ $ 126
>=1 Piece
Meo Food Co., Ltd.
Thick Ends Full Cuticle top quality Mink Brazilian 613 blonde silk straight Hair Cuticle Aligned Hair
$ 17 ~ $ 61
>=2 Piece
Meo Food Co., Ltd.
2019 Top Selling Russian Human Tape In Hair Extensions 100% Human Hair, Double Sided Remy Skin Weft Tape In Hair
$ 29 ~ $ 57.5
>=3 Piece
Meo Food Co., Ltd.
Letsfly wholesale 10pcs Straight Body Wave Ombre 1b/27 Dark Roots gold blonde Hair Bundles 100% Human Hair weaves
$ 19.5 ~ $ 52.1
>=10 Piece
Meo Food Co., Ltd.
Aosun Top Hair Vendors Mink Virgin Silky Brazilian Blonde Human Wick Hair, Unprocess Protein Cocochoco Brazilian Keratin Hair
$ 17.5 ~ $ 20
>=1 piec
Meo Food Co., Ltd.
wholesale 613 color brazilian human hair 360 lace frontal closure, body wave blonde hair bundles with lace closure
$ 20 ~ $ 75
>=1 Piece
Meo Food Co., Ltd.
Top Quality 10a 12a Remy Raw Mink Brazilian Cuticle Aligned Unprocessed Wholesale Bundle Virgin 100% Human Weave Hair Vendor
$ 8 ~ $ 100
>=2 Piece
Meo Food Co., Ltd.
Top Grade Long 30 Inches Silky Straight Wig Virgin Cuticle Aligned Hair straight 13*4 Lace Wigs
$ 79 ~ $ 192
>=10 Piece
Meo Food Co., Ltd.
top quality remy human hair 2.5 g per piece hand tied skin weft invisible tape in hair extensions
$ 1.8 ~ $ 3.9
>=40 Piece
Meo Food Co., Ltd.
5x5 Top Lace Closure Blonde 613 Platinum Remy Human Brazilian Body Wave Closure Swiss Lace With Baby Hair
$ 17 ~ $ 60
>=1 Piece
Meo Food Co., Ltd.
2020 trending products russian bundles 40 inch blonde hair extensions 613 blonde human hair weave
$ 16 ~ $ 16.83
>=1 Piece
Meo Food Co., Ltd.
wholesale lot human hair top blonde human virgin hair bundles 10a,curly beautiful princess hair
$ 5.2 ~ $ 8
>=1 piec
Meo Food Co., Ltd.
Multi Colors 6" Short Wavy Fringe Bangs Black Blonde Red Purple Blue Green Grey Ombre Real Human Hair Extensions
$ 2.63
>=1 Piece
Meo Food Co., Ltd.
Free Parting Top Grade Virgin Remy Hair Tangle Free Lace Closure 613 Blonde Frontal 13*4 Lace closure
$ 23.9 ~ $ 76.1
>=1 Piece
Meo Food Co., Ltd.
613 40 Inch Bundles Cuticle Aligned Virgin 613 Blonde Human Hair
$ 199 ~ $ 233
>=1 Piece
Meo Food Co., Ltd.
Related Searches:
leafhairpieceblondehairpiecesforshorthairnavyhairpiecefemalehairtoppersjanet27piecehair4cnaturalhairponytailextensionweddinghairpiecescanadabestponytailextensionsonepiececlipinhairextensionsforshorthairwomen'shairpieces27piecequickweavewigtoupeecolorquadweftonepiecehumanhairextensionsonepiecehairextensionshumanhairspringtwisthairpiecehairponytailshairpieceswigletsforthinninghairukbumphair27pieceshorthairtoupeebunclipsforhairwigs&hairpiecesbohohairpieces18inchponytailextensioncoloredhairpiecesbesthairextensionsforponytailcrownhairpieceforthinninghairombrehairpieceforbraidsrealhairpiecesthatclipongoldhairpiecesforbraids1piececlipinhumanhairextensions