Welcome to TradeChina
-
2020 the newest fashionable personal care gift set for man&women for home&hotel &travel
$ 2.89 ~ $ 4.36
>=500 Set
Meo Food Co., Ltd.
Essence of Luxury Spa Gift Bath Set Pure Spa Natural Skin Care Gift Set Makes Best Gift body works for man and woman
$ 1.99 ~ $ 3.98
>=500 Set
Meo Food Co., Ltd.
Best Sale Private Label Natural Oil Control Hyaluronic Acid Anti Acne Moisturizing Men Skin Care Set For Face
$ 10.7
>=1 Set
Meo Food Co., Ltd.
Best Men's Skin Care Products Private Label Mens Skin Care Set Face Cream Organic Men Face Skin Care Set Private Label
$ 2.68 ~ $ 6.88
>=1000 Set
Meo Food Co., Ltd.
Best facial moisturizer set oem skin care facial pore cleanser for men
$ 2.89 ~ $ 3.04
>=5000 Piece
Meo Food Co., Ltd.
Best Men's Skin Care Products Private Label Mens Skin Care Set Face Cream Organic Men Face Skin Care Set Private Label
$ 2.88 ~ $ 6.8
>=1000 Set
Meo Food Co., Ltd.
Best Wholesale Charcoal Skin Care Routine For Men Private Label Whitening Face Cream Organic Men's Skin Care Products
$ 6.12 ~ $ 11.5
>=3000 Set
Meo Food Co., Ltd.
2020 best deep cleaning face cleanser scrub men skin care private label natural organic men skin care set
$ 3.85 ~ $ 4
>=5000 Piece
Meo Food Co., Ltd.
Oem Private Label Profession Best Men Skin Whiten Care Facial Set
$ 7.6 ~ $ 8
>=1 Set
Meo Food Co., Ltd.
Organic skin care products whitening skincare set, best deep moisturizing cream dry skin herbal beauty cream
$ 8 ~ $ 10
>=24 Set
Meo Food Co., Ltd.
LAIKOU Men's Personal Skin Care Products Oil Control Anti Aging Rejuvenating Face Skin Care Set
$ 1.98 ~ $ 2.51
>=24 Set
Meo Food Co., Ltd.
private label best skincare organic face moisturizer cleanser lotion eye cream skin care for men
$ 1.5 ~ $ 5.5
>=10 Box(es)
Meo Food Co., Ltd.
Best whitening cream for skin care products set
$ 1.5 ~ $ 1.8
>=10000 piec
Meo Food Co., Ltd.
2020 new design OEM Wholesale valentine promotional aromatic body and bath gift set for man Best Moisturizing Body Wash
$ 2.28 ~ $ 3.46
>=500 Set
Meo Food Co., Ltd.
Private label organic Anti aging whitening skin care set cosmetics set
$ 8 ~ $ 10
>=24 Set
Meo Food Co., Ltd.
Odm/Oem Best Aromatic Custom Body Wash Bath Spa Shower Gel Body Care
$ 2.59 ~ $ 2.85
>=1 Piece
Meo Food Co., Ltd.
BINGJU Skin Care Product Men Oil Control Moisturizing Volcanic Mineral Men's Skin Care Set
$ 2.79 ~ $ 3.45
>=20 Set
Meo Food Co., Ltd.
OEM Private Label Best Selling Men Lifting Face Mask Sheet Moisturizing Firming Oil Control Men'S Facial Mask
$ 0.07 ~ $ 0.08
>=1000 Set
Meo Food Co., Ltd.
Best Wholesale Private Label Skin Care Men Deep Cleaning Oil Control Refreshing Moisturizing Men Facial Set Skin Care
$ 3.49 ~ $ 4.29
>=1 Set
Meo Food Co., Ltd.
Recommended For Handsome Men Skin Care Set Gift Facial Skin Care Set Best Sellers Hemp Vitamin C Skin Care Set
$ 7.33 ~ $ 11
>=200 Set
Meo Food Co., Ltd.
Refreshing Natural Private Lable Men Skin Care Whitening Best Organic Men's Skin Care Gift Sets
$ 2.68 ~ $ 6.88
>=1000 Set
Meo Food Co., Ltd.
ODM/OEM Best aromatic custom body wash bath spa gift set for man and woman
$ 1.98 ~ $ 3.66
>=500 Set
Meo Food Co., Ltd.
Anti wrinkle and anti aging skin care set with brightening skin five Set
$ 8 ~ $ 10
>=24 Set
Meo Food Co., Ltd.
LAIKOU Men Personal Skin Care Products Face Cleaner Toner Cream Rejuvenating Skin Care Set
$ 1.98 ~ $ 2.51
>=24 Set
Meo Food Co., Ltd.
BISUTANG Men's oil control moisturizing whitening cream skin acne cream, night face men skin caer cream
$ 0.78 ~ $ 0.79
>=100 Set
Meo Food Co., Ltd.
Private label cosmetics skin care set for dark skin and natural herbal organic face skin whitening facial kit oem odm
$ 10 ~ $ 30
>=10 Kilogram
Meo Food Co., Ltd.
Wholesale OBM brand best whitening night beauty girl cream,facial whitening skin care 6pc gift set
$ 8 ~ $ 10
>=24 Set
Meo Food Co., Ltd.
LAPEU Men Cosmetics Set Face Care Cleanser Toner Emulsion Revitalizing Refreshing Skin Care Set
$ 4.85 ~ $ 5.89
>=24 Set
Meo Food Co., Ltd.
Best Face Cleanser Toner Serum Moisturizer Charcoal Skin Men High Quality Custom Logo Whitening Korean Skin Care For Men
$ 2.68 ~ $ 6.88
>=1000 Set
Meo Food Co., Ltd.
Best Face Cleanser Toner Serum Moisturizer Charcoal Skin Men High Quality Custom Logo Whitening Korean Skin Care For Men
$ 3.98 ~ $ 7.8
>=1000 Set
Meo Food Co., Ltd.
anti aging skin care sets female mustache best personal laser hair removal for men
$ 43 ~ $ 49
>=5 piec
Meo Food Co., Ltd.
Best Selling Men Skin Care Set Private Label OEM ODM Hyaluronic Whitening Sensitive Best Men Skin Care Custom For Men'S And Wome
$ 7.5 ~ $ 18
>=500 Set
Meo Food Co., Ltd.
Facial Hair Beard Care Gift Set for Men Goatee Shaping Beard Grooming Kit Products
$ 2.8 ~ $ 6
>=500 Set
Meo Food Co., Ltd.
Full Face mask skin care set patch for anti aging, whitening, puffiness, anti wrinkle, moisturizing for women and men
$ 29.29
>=1 Carton(s)
Meo Food Co., Ltd.
Net Oem Best Sigma Lip Manly Matte Black32pcs Makeup Brushes Brush Set
$ 4.39 ~ $ 5.59
>=10 Set
Meo Food Co., Ltd.
Best Birthday Gift For Kids Women Men Bath Bomb Gift Set Custom Smell Bath Bomb On Sale
$ 0.36 ~ $ 0.45
>=100 piec
Meo Food Co., Ltd.
Best Luxury Natural Organic Green Tea Sandalwood Scented Skin Whitening Set Body Scrub And Body Lotion For Private Label
$ 1.2 ~ $ 2.85
>=250 Set
Meo Food Co., Ltd.
Best Selling Products Personalized New design men shaving brush set
$ 12 ~ $ 15
>=10 Set
Meo Food Co., Ltd.
Private Label best men skin care serum men whitening serum men face care whitening moisturizing face care set
$ 0.89 ~ $ 1.1
>=1 Box(es)
Meo Food Co., Ltd.
Wholesale Factory Best Selling Natural Moisturizing Cream Beard Care Organic Mens Beard Balm Set
$ 0.68 ~ $ 1.3
>=10 Piece
Meo Food Co., Ltd.
Professional Manufacturer Best Beard Care Set With Beard Oil Growth Kit Beard Shampoo Shaving Gel Natural Private Label
$ 2.06 ~ $ 3.17
>=100 piec
Meo Food Co., Ltd.
factory best price Man's gift daily clean beard soft skin shiny beard shampoo balm beard care set
$ 7.8 ~ $ 8.99
>=49 piec
Meo Food Co., Ltd.
OEM/ODM Best Selling Bamboo Charcoal l Black Hyaluronic Acid Nourishing Tightening Whitening Facial Mask For Men
$ 1.38 ~ $ 2.38
>=1 Set
Meo Food Co., Ltd.
2020 Best Selling Permanent Facial Painless Professional IPL Hair Removal for Women and Men
$ 25 ~ $ 38
>=1 piec
Meo Food Co., Ltd.
Amazon hot selling best price high quality new Jiacui natural factory jade roller with gua sha set
$ 1.38 ~ $ 3.35
>=1 piec
Meo Food Co., Ltd.
Best hemp body lightening lotion for black skin snow white strong whitening set hydration beauty bath and natural mens
$ 2.3 ~ $ 2.41
>=100 piec
Meo Food Co., Ltd.
Guangzhou empty 50ml and 50g clear round thick glass cosmetic bottle sets for body lotion
$ 0.44 ~ $ 0.55
>=2000 piec
Meo household Co.LTD
Wholesale Black White Ultrasonic Hot Handheld Ultrasound Exfoliating Remove Ultrasonice Face Scrubber For Women Men
$ 8.55 ~ $ 9
>=2 piec
Meo Food Co., Ltd.
best selling products in kenya protein solution body skin care for woman and men slimming body shaper
$ 63 ~ $ 64
>=1 Set
Meo Food Co., Ltd.
Scrubber Skin Scrubber. Skincare Brush Face Ems Ion Men For Emc Kit Lcd Set 2020 Best Dead Heat Mini Care Gold Pink Tool Metal
$ 20 ~ $ 23.5
>=1 piec
Meo Food Co., Ltd.
Related Searches:
bestfacialcleansersetbestmen'sfacecaresettheordinaryskincarekitatomytravelkitkoreanskincaresetforacneinnisfreebalancingsetkoreanskincareproductssetmen'sbodycaregiftsetskoreanskincarestarterkitolayskincaresettonymolyskincaresetjejuorchidskincaresetskinbrighteningsetfacialtreatmentsetskincareproductsgiftsetskinregimenkitdralvinsetproductsevehansenantiagingserumsetatomyskincaresetmensfacecreamgiftsetsatomyskincare4systemsensitiveskingiftsetsnailskincaresetcleansertonerandmoisturisersetinnisfreejejuorchidskincaresetabsoluteatomyskincareatomyset6brighteningwithglutasetfacecaregiftsetsjigottsnailessencemoistureskin