Welcome to TradeChina
-
RELATED CATEGORIES:
Hot Sale Colorful Brand Iron on Motif Rhinestone Heat Transfer for Shirt
$ 1.98 ~ $ 2.98
>=15 Piece
Meo Electronic Technology Co.LTD
generation heat transfer printing machine digital printer for heat transfer sticker
$ 750
>=1 Piece
Meo Textile Clothing Co.LTD
Qingyi print Iron on HTV gold silvery eco solvent printable heat transfer vinyl stivker paper for t shirts Inkjet Printer
$ 193
>=1 Roll
Meo household Co.LTD
China best quality large size 80x100 iron on t shirt transfers vinyl press machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Best Quality Iron On A4 Dark Fabric Heat Transfer Sheets
$ 1.2 ~ $ 1.4
>=5 Sheet
Meo household Co.LTD
Best price!fabric iron on transfer paper/transfer paper/iron on transfer paper for colored shirts
$ 0.3 ~ $ 0.4
>=50 Meter
Meo household Co.LTD
China best quality large size 80 100 iron on t shirt transfers vinyl press machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Best printable iron on clear inkjet heat white transfer paper sheets prices
$ 0.28 ~ $ 0.32
>=3000 Sheet
Meo household Co.LTD
Iron on Best Quality Heat Transfer Sublimation Paper for Pen Glass
$ 0.09 ~ $ 0.13
>=14200 Meter
Meo household Co.LTD
2020 China best quality 3g jet-opaque iron on dark t shirt printing paper heat transfer paper
$ 0.5 ~ $ 1
>=100 Bag(s)
Meo household Co.LTD
Best quality t-shirt heat transfer dark cotton iron-on t-shirt transfer paper
$ 39 ~ $ 60
>=1 Pack
Meo household Co.LTD
best heat press machine for small business,Hot sale Iron-on Hobby Heat Press Machine Mini with factory price
$ 99 ~ $ 119
>=1 Set
Meo Textile Clothing Co.LTD
Heat press machine for clothes best heat transfer machine heat screen print slide out cricut small
$ 318
>=1 Set
Meo Textile Clothing Co.LTD
Korea renlitong vinyl cricut heat transfer Iron on cheer leading transfers best iron on vinyl paper studio iron on vinyl
$ 0.2 ~ $ 0.3
>=100 Piece
Meo household Co.LTD
Korea renlitong vinyl cricut heat transfer Iron on cheer leading transfers best iron on vinyl paper studio iron on vinyl
$ 0.2 ~ $ 0.3
>=100 Piece
Meo household Co.LTD
Renlitong 61cm*25M chameleon Derict factory PU HTV iron on vinyl heat transfer paper for cloths
$ 69 ~ $ 84.5
>=1 Roll
Meo household Co.LTD
Printing machine printing mug combo heat sublimation fabric heat press tumbler heat press printin for sale rincons
$ 89
>=1 Set
Meo Textile Clothing Co.LTD
Printing machine industrial shirt press combo heat sublimation fabric heat press tumbler heat press printin for sale rincons
$ 177
>=1 Set
Meo Textile Clothing Co.LTD
Attachments for magic mug printing hat machine cricut easypress machine home depot screen print slide out cricut small
$ 77 ~ $ 100
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
laserwaterslidedecalpapersublimationprintingpapertransjetsublimationpaperbestpigmentinkprinterforheattransfersinkjetdarknocuttransferpapera3heattransferpaperbestphototransferpaperlaser1opaquetransferpapermetallictransferpaperthermalstickerpapertransparenttshirttransferpaperflocksublimationpaperceramictransferpaperselfweedinginkjettransferpaperaverydarktransferheatpaperbestinkjettransferpaperhotdarkjetinkaveryironontransfersprintertshirttransferpaperlaserjettransferpaperneenahjetopaquejetproprintablehtvtransferpaperamazonsublidarknocutvinylpaperfortshirtprintingsublimationpaperprinterbestprinterforheattransferpaperlightheattransferpaperaveryheattransfer