Welcome to TradeChina
-
whitening and moisturizing collagen facial skin care wholesale set 36pieces
$ 1.19 ~ $ 1.29
>=36 piec
Meo Food Co., Ltd.
Best Acne Treatment 2017 Skin Care Set Tea Tree Oil Skin Clearing Facial Wash Factory
$ 1.6 ~ $ 3.5
>=5000 Piece
Meo Food Co., Ltd.
Private label travel facial kit anti face acne treatment oily serum creams skincare gift hydrating moisturizing skin care set
$ 8.5 ~ $ 9
>=1 Set
Meo Food Co., Ltd.
Men Skin Care Set Amino Acid Facial Cleanser Best Natural Acne Deep Clean Face Wash Private Label For Men Oily Skin
$ 1 ~ $ 1.33
>=10 Piece
Meo Food Co., Ltd.
best electric sonic silicone face wash foam skin cleansing facial deep pore cleanser brush scrubber set for women oily dry skin
$ 14 ~ $ 15
>=1000 piec
Meo Food Co., Ltd.
Customized Logo Wash And Cream Best Oily Skin Whitening Face Wash
$ 1.8 ~ $ 2.8
>=500 piec
Meo Food Co., Ltd.
Spot Wholesale Best Face Skin Care Gift | 4 Organic Facial Masks Bonus Hair Band and Brush | Christmas Gift Clay Face Mask Set
$ 3.62 ~ $ 6.23
>=2 Piece
Meo Food Co., Ltd.
Private label cosmetics skin care set for dark skin and natural herbal organic face skin whitening facial kit oem odm
$ 10 ~ $ 30
>=10 Kilogram
Meo Food Co., Ltd.
Best quality and Effective Whitening ,brightening ,lightening skin care set
$ 1 ~ $ 15
>=1 Box(es)
Meo Food Co., Ltd.
Maximium hydration & protection best cosmetics natural face facial mask skin care set for dewy, hydrating and glowing skin
$ 29.29
>=1 Carton(s)
Meo Food Co., Ltd.
Private Label best pimples removal facial acne cream skin care cosmetic products set
$ 3.8 ~ $ 18
>=5000 Set
Meo Food Co., Ltd.
Best Sellers Facial Sheet Mask Set, Hydrating, Brightening, Oxygen-Bubbling, 24K Gold Glowing, Skin Care for Women
$ 3 ~ $ 5
>=100 Piece
Meo Food Co., Ltd.
Australian Tea Tree Oil Anti-acne Best Pimples Treatment Care Acne Away Cream Set with Facial cleanser
$ 5.4 ~ $ 9
>=12 Set
Meo Food Co., Ltd.
Caviar cosmetics best face wash facial cleanser
$ 2 ~ $ 5
>=100 Unit
Meo Food Co., Ltd.
Spa natural plant skin care serum and nourishing mask set for skin active super purifying best gift idea for mom, girlfriend
$ 58.57
>=1 Carton(s)
Meo Food Co., Ltd.
FEIQUE 2 In 1 Hot Sale Facial Care Set Soothes Whitening Kiwi Fruit Extract Skin Cream Set
$ 1.1 ~ $ 1.3
>=120 Set
Meo Food Co., Ltd.
OEM/ODM Eggplant Facial Mask cleaning clay mask facial scrub for oil dry skin trouble prone skincare purple mud mask portable
$ 0.56 ~ $ 0.95
>=3000 piec
Meo Food Co., Ltd.
today show beauty products 2021 face wash for dry and oily skin best eye brush set big face brush
$ 8.2 ~ $ 8.6
>=100 piec
Meo Food Co., Ltd.
Guangzhou eye mask set fluffy private label bag packaging gold collagen gel under funny best 24k vegan facial
$ 2.65 ~ $ 2.8
>=1000 piec
Meo Food Co., Ltd.
Best Selling Beauty Cosmetics Skin Care Set Vegan Organic Moisturizing Anti Aging Luxury Organic Turmeric Powder Face Clay Mask
$ 1.5 ~ $ 4.8
>=2 Unit
Meo Food Co., Ltd.
Private Label Face Care Serums Ampoules Avocado Vitamin Skin Care Capsule facial oil capsule
$ 0.6 ~ $ 0.72
>=1000 Unit
Meo Food Co., Ltd.
FEIQUE 2 In 1 Private Label Bright Whitening Lavender Extract Face Cream Set
$ 1.1 ~ $ 1.3
>=120 Set
Meo Food Co., Ltd.
Wholesale OEM Private Label Natural Organic Baby Skin Moisturizing Soothing Whitening Anti Aging Silk Mask Face Sheet Mask
$ 0.14 ~ $ 0.23
>=10 piec
Meo Food Co., Ltd.
OEM Private Label Wholesale Natural Repair Soothing Relief Anti Acne Hemp Face CBD Cream Light Hemp Cream Facial Hemp Acne Cream
$ 1.5 ~ $ 2.1
>=500 piec
Meo Food Co., Ltd.
Hot Products 2020 Brightens Repairs Anti-Aging Clay Mask Set Whitening Pore Cleansing Pink Clay Mask Acne Pink Private Label
$ 0.52 ~ $ 0.98
>=3000 piec
Meo Food Co., Ltd.
2020 Hot Popular custom Makeup Brushes 10PCS Beauty Brushes Makeup Cosmetics Kit Foundation Powder Blush Contour Make up brush
$ 1.34 ~ $ 2.08
>=50 piec
Meo Food Co., Ltd.
Non surgical best face and neck lift machine
$ -
>=1 Set
Meo Food Co., Ltd.
Related Searches:
skincareproductssetatomyeveningcare6setbestskincaresetformenjigottessencemoistureskincare3settheordinaryskincarekitsetkitinnisfreekoreanskinrejuvenatingsetbestfacialsetkoreanrejuvenatingsetmen'sfacecaregiftsetscetaphilskincaresetgoldenskincaresetfacialtreatmentsetsetskincarehadalabobodycaregiftsmarykaymen'sskincaresetantiacnesetmensfacewashsetaloeaquaskincaresetjigottsnailessencemoistureskinneutrogenaskincaresetmen'sfacecaresetdralvinsetpriceetudehouseskincaresetvlccantitanfacialkitsetof5absoluteatomyskincarebestskincaresetsforoilyskincetaphilsetskincaredralvinsetproductsmarykaytimewiserepaircleanser