Welcome to TradeChina
-
RELATED CATEGORIES:
- Baby Children & Maternity
- Building Materials
- Electronics & Appliances
- Furniture & Decoration
- Homelife
- Industrial Machinery
- Agricultural Machinery
- Material Handling
- Commercial Equipment & Machinery
- Compressors, Refrigeration & Heating Equipment
- Fasteners & Processing Equipment
- Food & Beverage Machinery
- Home Goods & Chemical Product Manufacturing Machinery
- Machine Tools & Metalworking
- Metallurgy, Minerals & Energy
- Power Transmission
- Vehicle Accessories, Electronics, & Tools
- Packaging & Printing
- Metals & Alloys
- New Energy
- Textiles & Garments
Automatic card vending RFID card issuing machine with reader &writer module
$ 50 ~ $ 120
>=1 Unit
Meo Textile Clothing Co.LTD
lianye beverage /snack/food/drink /coffee automatic vending machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Factory price gumball/ toy / candy automatic sweet vending machine
$ 30 ~ $ 50
>=100 Piece
Meo Textile Clothing Co.LTD
Yogurt ice cream vending machines coin operated automatic ice cream vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
High Mixing Speed Commercial Protein Shake Vending Machine For Gym And Athletics Centre
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hot Sale Self Service automatic Laundry detergent vending machine
$ 800
>=100 piec
Meo Textile Clothing Co.LTD
Coffee, milk tea, juice 3 flavors coin-use auto coffee vending machine
$ 200
>=1 Unit
Meo Textile Clothing Co.LTD
2017 newest automatic ticket vending machine ticket dispenser
$ 13 ~ $ 18
>=1 Piece
Meo Textile Clothing Co.LTD
Fully Automatic Espresso Coffee Vending Machine -Golden Milano E3S
$ -
>=70 Unit
Meo Textile Clothing Co.LTD
mask auto vending machines
$ 700 ~ $ 800
>=10 piec
Meo Textile Clothing Co.LTD
Biue and White With No Top Display Cabinet Gacha Machine/Three-tier Red and Black Wheeled Toy Vending Machine With Flexible sale
$ 195 ~ $ 235
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Sticker photo booth vending machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Hot Sale Led Screen Non-contact Aerial Imaging Ticket Vending Machine For Outdoor
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Whole sale automatic smart digital vending machine drink instant noodle lollipop pringles snack combo vending machine
$ 299 ~ $ 599
>=1 Set
Meo Textile Clothing Co.LTD
Mask Vending machine with lcd advertising screen
$ 899
>=1 Set
Meo Textile Clothing Co.LTD
fully automatic reverse custom cosmetic pizza small vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Spaceman automatic desktop ice cream machine italian snack soft ice cream vending machine
$ 100
>=1 Unit
Meo Textile Clothing Co.LTD
Coin Operated Toys Capsule Gashapon Vending Machine Capsule vending machine
$ 180 ~ $ 190
>=1 Set
Meo Textile Clothing Co.LTD
DVD Vending and Rental Kiosk for DVD Video Automatic Rental Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Integrated Automatic Payment Vending Machine Shell Self-service Check-in Sheet Metal Box
$ 318 ~ $ 341
>=1 Piece
Meo Textile Clothing Co.LTD
Automatic Ticket Vending Machine With Card Dispenser
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Candy Vending Machines vending machine automatic vending machine
$ 132 ~ $ 153
>=1 piec
Meo Textile Clothing Co.LTD
Convenience store automatic snack and drinkc ombo self-service vending machine with Ad play
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Self-service Automatic Vending Machine With Face Recognition And Advertising Player Floor Stand And Wall Mount
$ 677 ~ $ 770
>=1 piec
Meo Textile Clothing Co.LTD
Coffee Vending Machine mixing in cup
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Professional Design Mask Black Vending Machine Combo Hand Sanitizer Face Mask Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2014 New High Quality Automatic Milk Vending Machine
$ 500
>=1 Piece
Meo Textile Clothing Co.LTD
2019 Hot Sale Different Style Automatic Vending Machine Toys With Touch Screen
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
automatic fast food cup noodle coin vending machine
$ -
>=8 Piece
Meo Textile Clothing Co.LTD
Human Security Equipment Vending Machine - For Industries
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
21.5 inch Automatic Face Mask Vending Machine vending equiment slim mask making machine
$ 500 ~ $ 580
>=1 Unit
Meo Textile Clothing Co.LTD
New trending automatic, mask dispenser for sell/facemask vending machine/
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Automatic Fresh Squeezed Orange Juice Vending Machine Manufacturer
$ -
>=5 Set
Meo Textile Clothing Co.LTD
CE certified bill and coin acceptor automatic fresh milk atm milk vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Commercial coin operated automatic laundry vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Blueway Automatic Vending Machine for bus, car, taxi
$ 600 ~ $ 800
>=2 Set
Meo Textile Clothing Co.LTD
snacks and drinks & combo vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
high capacity snacks and drinks vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
automatic commercial hot food coffee vending machine
$ 410
>=1 Set
Meo Textile Clothing Co.LTD
automatic coin operated water vending machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Automatic snack fast frozen food vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Sino Star Hot selling Currency Changer coin exchange machine token change smart automatic indoor vending machine
$ 805 ~ $ 885.5
>=1 Set
Meo Textile Clothing Co.LTD
Automatic soft ice cream vending with customize payment system for coin or banknote
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Vending type mask machine machines sale automatic
$ 950
>=1 Set
Meo Textile Clothing Co.LTD
Japanese beauty fortune vending machine of different languages
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Smart Automatic Touch Screen Snacks And Drinks Vending Machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Automatic Fresh Fruit Orange Juice Vending Machine
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Self-service Wall Mount And Floor mount Automatic Vending Machine With Face Recognition And Advertising Player
$ 677 ~ $ 770
>=1 piec
Meo Textile Clothing Co.LTD
the most popular fresh vegetable automat food vending machines for supermarket
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Vending Machine with prize Shopping Mall Automatic Gift Prize drinks fruit juice foods self vending machine With Bill Acceptor
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
vendingsystemintelligentvendingmachinecontactlessvendingmachineforsaledrinkmachinenearmecandymachinetoyautomaticchocolatevendingmachinepeanutvendingmachinesodamachinecostautomaticcoffeevendingmachinelaysvendingmachinelypcgumballmachinehotvendingmachines1950scokemachinecoinoperatedcandydispensersmartvendingsolutionsbianchivendingmachinebubblegumvendingmachinesolarpoweredvendingmachinegumvendingmachineusedcokemachinesoftdrinkmachinepricefrozenfoodvendingmachinescoffeepremixforvendingmachinenorthwesternvendingmachinesexpendingmachineskittlesvendingmachineforsalesimcardvendingmachinevendopepsimachinevendingmachinelocatorsfooddispensermachine