Welcome to TradeChina
-
RELATED CATEGORIES:
- Baby Children & Maternity
- Building Materials
- Electronics & Appliances
- Furniture & Decoration
- Homelife
- Industrial Machinery
- Agricultural Machinery
- Material Handling
- Commercial Equipment & Machinery
- Compressors, Refrigeration & Heating Equipment
- Fasteners & Processing Equipment
- Food & Beverage Machinery
- Home Goods & Chemical Product Manufacturing Machinery
- Machine Tools & Metalworking
- Metallurgy, Minerals & Energy
- Power Transmission
- Vehicle Accessories, Electronics, & Tools
- Packaging & Printing
- Metals & Alloys
- New Energy
- Textiles & Garments
24 hours self-service automatic vending machine/vending locker
$ -
>=5 Unit
Meo Textile Clothing Co.LTD
Vending machine t-handle lock vending machine parts safe lock cylinder safe lock cylinder
$ 7.7
>=1000 Piece
Meo Textile Clothing Co.LTD
Eletronic locking system 80mm thermal receipt panel printer for vending machine
$ 130 ~ $ 138
>=10 piec
Meo Textile Clothing Co.LTD
Breath Alcohol Tester Vending Machine
$ 38 ~ $ 338
>=50 Piece
Meo Textile Clothing Co.LTD
RO Water Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Factory manufacture China High Precision machining cnc vending coffee machine parts
$ 0.1 ~ $ 1
>=100 Piece
Meo Textile Clothing Co.LTD
24 hours automatic self vending machines for gifts, hair, toys
$ -
>=2 Set
Meo Textile Clothing Co.LTD
wine vending machine automatic cup wine dispenser
$ -
>=10 Set
Meo Textile Clothing Co.LTD
smart 24 hours self-service automatic coffee vending machine
$ 497.7 ~ $ 574.1
>=10 Piece
Meo Textile Clothing Co.LTD
Cheapest easy use commercial coffee vending machine
$ 290 ~ $ 460
>=10 piec
Meo Textile Clothing Co.LTD
TCN smart 24 hours self-service automatic milk food snack drink vending machine with CE CB ISO9001
$ -
>=1 Set
Meo Textile Clothing Co.LTD
TCN automatic fast food breakfast lunch box vending machine for sale
$ -
>=3 Set
Meo Textile Clothing Co.LTD
Zoomgu Large capacity automatic combo snacks drinks vending machines
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
AFEN 22 inch touch screen automatic cold sandwich health food vending machines
$ -
>=2 Set
Meo Textile Clothing Co.LTD
AFEN hot sell automatic snack drink smart cheap combo vending machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Indian Manufacturer Automatic Instant Premixes Tea Coffee Vending Machine
$ 140 ~ $ 520
>=1 Set
Meo Textile Clothing Co.LTD
SNBC BVM-RI260 Vending Machine For Foods And Drinks Machines For Sale Automatic Combo Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Automatic self mart mouted wall small vending machine wall-mounted mini vending machine for condom
$ 399 ~ $ 599
>=2 Set
Meo Textile Clothing Co.LTD
1 year warranty Coffee/Hot Chocolate/Creamer Vending Machines
$ 410
>=1 Set
Meo Textile Clothing Co.LTD
WiFia202 Coin Operated 24 Hours Self-Service Computer Hardware Automatic WiFi Vending Machine
$ 372 ~ $ 389
>=1 Unit
Meo Textile Clothing Co.LTD
Earn money ice cream vending machine cosmetics protein shake vending machine automatic
$ -
>=1 Set
Meo Textile Clothing Co.LTD
coffee vending machine/OEM ODM commercial automatic electric coffee vending machine/coffee machine automatic payment
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
Lebanon automatic bread and burger vending machine with 66 selections
$ -
>=1 Set
Meo Textile Clothing Co.LTD
World best selling products orange juicer vending machine automatic for commercial use
$ -
>=3 piec
Meo Textile Clothing Co.LTD
Touch screen self-service payment vending machine selling snacks and drinks automatically
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic machine/Toy/Gumball /Candy/Snack/ Vending machine
$ 28 ~ $ 33
>=10 Piece
Meo Textile Clothing Co.LTD
OEM Coin Operated Bottle Purified Water Vending Machine Commercial Automatic Cool Water Vending Equipment for Drinking
$ -
>=1 Set
Meo Textile Clothing Co.LTD
small smart automatic capsule vending machine
$ 990
>=1 piec
Meo Textile Clothing Co.LTD
Top Up Automatic Bmi Height Weight Self Service Smart Supermarket Hospital Pharmacy Vending Machine
$ 460 ~ $ 550
>=1 piec
Meo Textile Clothing Co.LTD
Automatic soft ice cream vending machine cash operated
$ -
>=1 Set
Meo Textile Clothing Co.LTD
coin operated automatic soft ice cream vending machine ice-cream cone vending machine
$ -
>=1 Piece
Meo Textile Clothing Co.LTD
CE CB ISO9001 approved vending machine smart 24 hours self-service automatic food snack drink vending with 50inch touch screen
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Smart 24 Hours Self-service Automatic Milk Food Snack Drink Vending Machine With Ce FCC Iso9001
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Pasmo S110F agitator CE ETL certification automatic soft ice cream vending machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
2020 popular Custom Automatic Vending Machine Face Mask Vending Machine
$ 700 ~ $ 800
>=1 piec
Meo Textile Clothing Co.LTD
Best price of popcorn vending machine automatic salad vending machines digital vending machine with cheapest price
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Automatic cold drinks beverage vending machine with fashion design
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Juice, Milk Tea, Ice Tea, Coffee Cold Beverage Dispenser Token Coins Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheap Self-service Auto Face Mask Vending Machine Dispenser Surgical Mask Vending Machine For Small Items Automat
$ 198 ~ $ 218
>=1 piec
Meo Textile Clothing Co.LTD
Smart automatic face mask wall mounted vending machine with large capacity
$ 198 ~ $ 218
>=1 piec
Meo Textile Clothing Co.LTD
Pizza Sandwich Food cooking vending machine with 47inch touch screen
$ -
>=10 piec
Meo Textile Clothing Co.LTD
TCN-D720-6G Chips Chocolates Drinks Snacks Automatic Mini Vendor Machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Coin Operated Water Vending Machine
$ -
>=12 Set
Meo Textile Clothing Co.LTD
Automatically selling soap liquid laundry liquid automatic liquid dispenser multi coin acceptors
$ 5.15 ~ $ 6
>=1 Piece
Meo Textile Clothing Co.LTD
Kids toy egg automatic japanese gacha gashapon vending capsule toys game machine plastic toy capsule vending machine
$ 170
>=100 piec
Meo Textile Clothing Co.LTD
Tremenda automatic pizza vending machine pizza machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Bubble toy capsule Vending Machine on stand SD09/Gashapon Toys Vending Machine
$ 42.5 ~ $ 44
>=10 Set
Meo Textile Clothing Co.LTD
Ice cream vending machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
OEM 2020 Popular Snack Vending Machine 11Channels Coin Operated Combo Vending Machine for Sale Promotion
$ 978
>=1 Set
Meo Textile Clothing Co.LTD
High quality 3 different kinds automatic coin operated tea time coffee vending machine with auto cup WF1-303V
$ 160 ~ $ 200
>=1 Piece
Meo Textile Clothing Co.LTD
Related Searches:
coffeepremixforvendingmachinevendingmachinelocatorsmilkvendingmachinepricevendingsystemquartercandymachinevintagevendingcontactlessvendingmachineforsalelocalvendingmachinecompaniesfrozenvendingmachinecoldfoodvendingmachinessmartvendingsolutionsfooddispensermachinetoycapsulemachinedonutvendingmachinecashlessvendingmachinespopvendingmachineforsaleusedcombovendingmachinesnorthwesternvendingmachinesdrinkmachinenearmeteaandcoffeemachineforofficedrinkvendingmachinenearmepizzafornovendingmachinevendingcoffee1950scokemachineoldpepsivendingmachineicevendingmachinebusinessbeervendingmachineforsalevendopepsimachineskittlesvendingmachineforsaleminipopmachine