Welcome to TradeChina
-
RELATED CATEGORIES:
Good Price Coffee Maker Machine Automatic Vending Machine For Coffee And Drinks
$ 408 ~ $ 568
>=1 Piece
Meo Textile Clothing Co.LTD
2021 Business Idea Cheap Vending Machine Automatic PPE Face Mask Vending Machine
$ 198 ~ $ 218
>=1 Piece
Meo Textile Clothing Co.LTD
School and Supermaket Use Self Coffee Tea Vending Machine Best Price
$ 650 ~ $ 720
>=2 Set
Meo Textile Clothing Co.LTD
coffee vending machine outdoor fully automatic commercial coffee making machine price
$ 799
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Food And Beverage Wifi Vending Machine Price
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
High Quality Cheap Price vending machine control board coffee machine automatic vending vending machine cold drinks
$ 520 ~ $ 545
>=1 Piece
Meo Textile Clothing Co.LTD
SCENTHOPE best Price Automaitc Self Service Touch Screen Instant Tea Coffee Vending Machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
High Mixing Speed Commercial Protein Shake Vending Machine For Gym And Athletics Centre
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Competitive Price Coffee Machine Vending Cold Automatic Coffee Vending Machine
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
Factory price gumball/ toy / candy automatic sweet vending machine
$ 30 ~ $ 50
>=100 Piece
Meo Textile Clothing Co.LTD
outdoor tabletop smart coin bill acceptor automatic operated machines bean to cup instant coffee vending machine cheap price
$ 900
>=1 Set
Meo Textile Clothing Co.LTD
Coffee vending machine automatically dispense cups
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Two space coin operated kiosk Token automatic wifi vending machine coin acceptor price
$ 66 ~ $ 199
>=1 Piece
Meo Textile Clothing Co.LTD
Convenience Store Automatic Snack and Drink Combo Advertisement Self-Service Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Vending Machine Arcade Machine Price Crane Claw Machine For Game Center
$ 650 ~ $ 680
>=1 Unit
Meo Textile Clothing Co.LTD
Fully automatic instant table coffee vending machine good price
$ -
>=2 Piece
Meo Textile Clothing Co.LTD
Hot Sale Low Price With Touch Screen Hot Coffee Tea Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Cheap Price Gift Box Cosmetics Lipstick Retail Vending Machine for Subway
$ 800
>=1 Set
Meo Textile Clothing Co.LTD
Smart 24 Hours Automatic Vending Lockers Coffee
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
automatic fast food cup noodle coin vending machine
$ -
>=8 Piece
Meo Textile Clothing Co.LTD
automatic rice dumpling samosa momo hot food sandwich vending machine at good price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coffee Vending Machine Price Commercial Automatic Coffee Machine Vending
$ -
>=10 Unit
Meo Textile Clothing Co.LTD
Big Capacity High-end Business 24 hours Automatic Wine Vending Machine Price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Automatic Selling Drink Cooling Vending Machine Factory Price by Refrigeration customized
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Most Popular Automatic Commercial Water Vending Machine With Coins And IC Card Accepter
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory Price Automatic Lemon Juicer Machines Fresh Orange Juice Vending Machine for Sale
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Self-service Vending Machine Best Price With Good Quality
$ 510
>=1 Set
Meo Textile Clothing Co.LTD
2016 new design automatic mandarin orange juice vending machine
$ -
>=50 Piece
Meo Textile Clothing Co.LTD
With coin and bill payment tabletop snack vending machine/food vending machine/mini vending machine
$ 380 ~ $ 480
>=1 Unit
Meo Textile Clothing Co.LTD
professional multifunctional full automatic 200l raw milk vending machine price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
OEM Commercial Beverage Cigarette Candy Vending Machine 24 Hours Self-service Milk Snack Drink Vending machine with CE
$ 820 ~ $ 950
>=1 Set
Meo Textile Clothing Co.LTD
japanese wall mount vending machine for false lashes
$ 549.99
>=1 Set
Meo Textile Clothing Co.LTD
Sapoe high quality 2 different kinds automatic coin operated tea time coffee vending machine
$ 200
>=1 piec
Meo Textile Clothing Co.LTD
Good price different type customized drink cup noodle cake gum ball vending machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Saec function high quality coffee vending machine price
$ 150 ~ $ 250
>=10 piec
Meo Textile Clothing Co.LTD
High quality automatic parking card dispenser with card reader module for ticket vending machines
$ 130 ~ $ 198
>=1 Unit
Meo Textile Clothing Co.LTD
HUIZU WM0-2 Micron Made in China High quality elevator lift type maquina expendedora vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory Price 24 hours self service commercial auto sealing bag Ice Vending Machine with 450KG big production
$ -
>=5 piec
Meo Textile Clothing Co.LTD
China factory wholesale price capsule-toy vending machine coin operated gashapon vending machine
$ 79.2 ~ $ 85.5
>=1 piec
Meo Textile Clothing Co.LTD
Competitive price Coin Operated Outdoor Drinking Water Vending Machine Automatic Water Filling Machine Dispenser Promotion
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory Price Automatic 55" Touch Screen Media Drink Vending Machine
$ -
>=5 Set
Meo Textile Clothing Co.LTD
Afen china manufacturer supply competetive price refrigerated automatic vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Malaysia Self Service Serve Price List A Coin Operated Automatic Soft Ice Cream Vending Machine Ice-Cream Cone Vending Machine
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Automatic vending machine from China yinong factory GS505 maquinas expendedora bebidas
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Best selling products automatic vending machine ice cream price high quality
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Factory Price 24hours service Cash Function Automatic commercial outdoor Self-Service Ice Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Factory Price 24hours service Cash Function Automatic commercial outdoor Self-Service vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
very low price automatic soft ice cream vending machine with excellent service
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Factory price Zhutong coin token operated branded toy capsule vending machine kapsel automat gashapon vending machine
$ 147.6 ~ $ 158.4
>=1 piec
Meo Textile Clothing Co.LTD
commercial outdoor ice cream vending machine customized payment automatic ice vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Related Searches:
nayaxcardreaderlaysvendingmachinecakevendingmachinemeivendingmachinedonutvendingmachinevendingshopsnacksvendingmachinepriceintelligentvendingmachinesoftdrinkmachinepricevendingmachinebusinessforsalenearmenectacoffeemachinepricebianchivendingmachinebusinesseslookingforvendingmachinessimcardvendingmachinesolarpoweredvendingmachinevendingmachinesforsaleebaysodacanmachineantaresvendingmachinevendingmachinelocatorsdrinkmachinenearmenescafecoffeevendingmachinepricecoffeevendomachineforsalecarddispensermachinecashlessvendingmachinesnewandusedvendingmachineslypcgumballmachineantiquecocacolamachineoldpepsivendingmachineusedsodavendingmachinesforsalenearmecafecoffeedayvendingmachineprice