Welcome to TradeChina
-
RELATED CATEGORIES:
37GA555 DC Gear Motor with Encode For Robot
$ 6.69 ~ $ 11.62
>=100 Piece
Meo Textile Clothing Co.LTD
Full automatic non-woven medical disposable outside earloop face mask machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Self Service Payment / Android Pos/ Kiosk Machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
ARM IMX6 Series Single Board Computers ENC-F501 Motherboard
$ 90 ~ $ 126
>=1 Piece
Meo Advertising Co.LTD
Andriod Touch Screen Kiosk Machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Supermarket/ Automatic Bill Exchange Machines
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Carbon brush low noise engine 12v dc rotisserie gear motor
$ 2.98 ~ $ 4.65
>=500 Piece
Meo Textile Clothing Co.LTD
Kiosk Note Acceptor/ Cafes/ Pos Machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Coins/Notes Dispensing Self Service Checkout Kiosk
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Foor Standing Kiosk Machine Bill Acceptor
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Restaurant Self Service Bill Recycler Kiosk
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Standing Smart Cash Kiosk Machine / Register
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Fast Food/ Cafes Self Service Kiosk Machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Payment Kiosks Supermarket Multicurrency Kiosk Machine Made In Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
2-7mm 12-13 axis Top sale high speed cnc torsion spring machine spring coil making machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Singapore Payment Machine Standing Smart Cash Kiosk Machine / Register
$ 760 ~ $ 800
>=10 Piece
Meo Textile Clothing Co.LTD
Singapore Manufacturing Self Serving Restaurant Self Service Bill Recycler Kiosk
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Self Service Supermarket And Restaurant Supermarket/ Automatic Bill Exchange Machines
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Kiosk Notes Machine Recycler/ Standalone Kiosk Machine Made In Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Cash Pos Machine Kioks Multicurrency Kiosk Machine Made In Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Supermarket Cash Machine Restaurant Self Service Bill Recycler Kiosk Cash Machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Self Service Kiosk Note Acceptor/ Cafes/ Pos Machine Made In Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Touch Screen Computer Kiosks Andriod Touch Screen Kiosk Machine From Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Computer Touch Screen Andriod Touch Screen Kiosk Machine Made In Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Wholesale From Singapore Self Service Kiosk Machine Andriod Touch Screen Kiosk Machine
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Self Service Best Seller Floor Standing Kiosk Machine Bill Acceptor Made In Singapore
$ 690 ~ $ 720
>=10 Piece
Meo Textile Clothing Co.LTD
Computer Self Service Kiosk Machine Floor Standing Kiosk Machine Bill Acceptor Made In Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Singapore Touch Screen Self Service With QR Reader Standing Smart Cash Kiosk Machine / Register
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Smart 24/7 Self Service Kiosk Standing Smart Cash Kiosk Machine / Register Made In Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Open Frame 21.5 Inch LED Touch Screen Monitor outdoor lcd display
$ 299 ~ $ 499
>=1 Piece
Meo Advertising Co.LTD
electrical package container locker
$ 278 ~ $ 350
>=1 piec
Meo Textile Clothing Co.LTD
Garbage recycle machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
One arm touchless electric car wash machine for washing shop with high pressure car wash system
$ -
>=1 Set
Meo Bio Energy Sales Co.LTD
Click And Collect Fresh Food Lockers
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Electric Curtain 6v 12v 100rpm dc gear motor
$ 3.61 ~ $ 5.48
>=1 Piece
Meo Textile Clothing Co.LTD
2 PCI slot fanless all in one capacitive touch panel pc industrial
$ 765 ~ $ 815
>=1 piec
Meo Advertising Co.LTD
Condom dispenser
$ 350 ~ $ 400
>=1 Piece
Meo Textile Clothing Co.LTD
Factory price OEM touch all in one fanless industrial pc with PCI slot
$ 710 ~ $ 799
>=1 piec
Meo Advertising Co.LTD
Notes Machine Recycler/ Standalone Kiosk Machine Made In Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
15 inch fanless all in one embedded X86 outdoor industrial hmi touch screen panel pc i5 with PCIex16
$ 765 ~ $ 815
>=1 piec
Meo Advertising Co.LTD
High quality fanless 15 inch all in one PC touch screen Industrial computer
$ 760 ~ $ 774.25
>=1 piec
Meo Advertising Co.LTD
15inch capacitive touch screen all in one industrial computer ip65 with 2*PCI or 1PCIe
$ 765 ~ $ 815
>=1 piec
Meo Advertising Co.LTD
15 inch energy saving i5 all in one dual LAN embedded industrial panel pc support 2PCI
$ 765 ~ $ 815
>=1 piec
Meo Advertising Co.LTD
Chiller/Freezer Asset Management Lockers
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Chilong A4 Colorful waterproof round Push Button Switch
$ 0.1 ~ $ 0.5
>=100 Set
Meo Advertising Co.LTD
Hospital administration software Capacitive Screen queuing kiosk self-service Queue Management System
$ 500
>=1 piec
Meo Textile Clothing Co.LTD
mini dc moteur 12 volts 10rpm door lock actuator motor
$ 9.25 ~ $ 10.85
>=1000 piec
Meo Textile Clothing Co.LTD
Cash Dispensing Recycling Kiosk ATM Machine
$ -
>=5 Piece
Meo Textile Clothing Co.LTD
Intelligent Lockers fruit juices / protein shake Gyms Smart Cabinet
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Pos With Weighting Scale Cash Register RFID Self Checkout Table For Restaurant From Singapore
$ -
>=10 Piece
Meo Textile Clothing Co.LTD
Related Searches:
nectacoffeemachinepricesodamachinecostsimcardvendingmachinecoffeedaymachinecosticecreamvendingmachineforsalevintagevendingsodavendingmachinebusinesscappuccinovendingmachinenewandusedvendingmachineshotmealvendingmachinemechanicalvendingmachinevendingsupplybestsellingvendingmachinecandycandymachinetoytopvendingmachinecompaniesbestcoffeevendingmachinespizzafornovendingmachinevendingmachinesforsaleebaypopvendingmachineforsaledonutvendingmachinepepsimachinesoldpepsivendingmachinedrinkvendingmachinenearmeicevendingmachinebusinessforsalecarddispensermachinevendingmachinebusinessforsalenearmemeivendingmachinepeanutvendingmachinesnacksvendingmachinepricevendingsystem