Welcome to TradeChina
-
RELATED CATEGORIES:
30 OZ stainless steel tumbler high quality vacuum metal double wall insulated beer mug 100% BPA free
$ 2.3 ~ $ 2.45
>=1000 Piece
Meo Food Co., Ltd.
bpa free custom color custom logo sports bidon
$ 0.92
>=1000 Piece
Meo Food Co., Ltd.
Wholesale Custom Eco-Friendly 17oz BPA Free Plastic 3 Layers Fitness Protein Shaker
$ 1.49 ~ $ 1.98
>=50 piec
Meo Food Co., Ltd.
20oz Double Wall Vacuum Insulated Travel Mug, Stainless Steel Tumbler with Lid and Straw
$ 0.1 ~ $ 3
>=100 Piece
Meo Food Co., Ltd.
Klooper Fitness Project 17 Oz Cola-Shaped Double Wall Vacuum Cool Insulated Stainless Steel Water Bottle with Leak-Proof and No
$ 2.98 ~ $ 4.98
>=1 Piece
Meo Food Co., Ltd.
Klooper 20 Oz Double Wall Vacuum Insulated Slim Sublimation Blank Straight Skinny Stainless Steel Tumblers
$ 2.55 ~ $ 2.6
>=50 Piece
Meo Food Co., Ltd.
Related Searches:
diybirdfeederwithplasticbottlecraftplasticplasticcanvasmagnetsplasticbottlecraftplasticcanvaschristmasplastictapestrycanvaspvcpipekidprojectscraftstringplasticplasticpipecraftembroideryonplasticplasticstrawweavingplasticanimalcraftsplasticbagflowermakingrecycledplasticweavingplasticcanvasstitchesetsyplasticcanvasplasticballcraftplasticbagdiycraftssusanbatesplasticcrochethooksplasticbottlecraftsadultswaterbottlecraftsforpreschooluseofplasticbottlesincraftcrochetbagsfromplasticbagsplasticartprojectsdiykeychainplasticplasticbottlecraftprojectsplasticbottlecapmagnetsplasticcanvasbytheyarddiyplasticbottleartplasticcanvaseaster