Welcome to TradeChina
-
Best seller free standing snack drink vending machine with lifetime free maintenance service
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coin operated food vending machine with belt conveyor
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Fresh Food Fruit Vegetable Salad Elevator Egg vending machine TCN-D900-9G
$ -
>=1 Set
Meo Textile Clothing Co.LTD
2 Column Tattoo & Sticker Vending Machine (TM250)
$ 140 ~ $ 150
>=20 Piece
Meo Textile Clothing Co.LTD
Extended Round Bounce Ball Vending Machine TR522
$ 38 ~ $ 40
>=100 Piece
Meo Textile Clothing Co.LTD
2-Column Card, Condom, Napkin, Sanitary Vending Machine TR422
$ 95 ~ $ 100
>=50 Piece
Meo Textile Clothing Co.LTD
Full Mechanical 4 Selections Condom Vending Machine (TR644)
$ 135 ~ $ 150
>=50 Piece
Meo Textile Clothing Co.LTD
2020 factory lower price vending equipment for sale
$ 250
>=1 Piece
Meo Textile Clothing Co.LTD
24 hour self service snack vending machine with card reader for food pizza
$ -
>=2 piec
Meo Textile Clothing Co.LTD
Mini Gashapon Machine Kids Blind Egg 7.5 cm Toy Balls Capsule Gacha Vending Machine for sale
$ 200 ~ $ 250
>=1 Unit
Meo Textile Clothing Co.LTD
New vending machine support cash payment system
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Wall-mounted Coffee And E-ciggarettes Mini Vending Machine
$ 456 ~ $ 554
>=1 piec
Meo Textile Clothing Co.LTD
Automatic Instant Milk Tea Coffee Powder Vending Machine With Cup Dispenser
$ 420 ~ $ 520
>=1 Acre(s)
Meo Textile Clothing Co.LTD
Large Globe Gumball Vending Machine (TR503R)
$ 36 ~ $ 37
>=100 Piece
Meo Textile Clothing Co.LTD
HUIZU WM22-W power bank vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
hot cup noodle saleblack power bank book jewelry top up combo vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
eyelash vendor vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
HUIZU WM22T Micron China customized machine jewelry vending machine with big capacity
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Bank ATM Automatic currency exchange Teller Machine
$ -
>=1 piec
Meo Textile Clothing Co.LTD
Power Bank Sharing Rental Station with 5 Power Banks Self-service Auto Face Surgical Mask Vending Machine for Mask otomat
$ 300 ~ $ 340
>=2 piec
Meo Textile Clothing Co.LTD
Automatic Cake Salad Fruit Vending Machine with Cashless Payment
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Easy operation cake vending machine with coin bill payment devices
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Cashless cake fruit vending machine with recyclable function
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
Automatic cup noodle cake fruit vending machine with credit card payment
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
TCN soup alcohol wine vending machine with 22 inch touch screen
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Lift System Cup Noodle Cake Kiosk Vending Machine Dispense Eggs with Elevator
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
2019 New Business 22inch Touch Screen Protein Drinks Vending Machine in Thailand
$ -
>=5 Piece
Meo Textile Clothing Co.LTD
Coffee Machine Espresso Drinks Vending Machine
$ 480
>=8 Piece
Meo Textile Clothing Co.LTD
wig vending machine for hair Cosmetic vending machine can be sale makeup Lipstick with outside vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Coin Operated Snacks Condoms Small Items Wall-mounted Vending Machine
$ 456 ~ $ 554
>=1 piec
Meo Textile Clothing Co.LTD
Make up Cosmetic Vending machine for beauty products
$ -
>=1 Set
Meo Textile Clothing Co.LTD
32 Grids Cooling Locker Vending Machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
small combo touch screen vending machine for snack
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Vendlife Best 19 Inch Touch Screen Daily Use Hook Food Snack Vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Hotel Room 20 Grids Fruit Vegetables Case Box Vending machine
$ 800 ~ $ 900
>=5 Set
Meo Textile Clothing Co.LTD
Custom Smart Hair Beauty Vending Machines with Large Touch Screen
$ -
>=1 Set
Meo Textile Clothing Co.LTD
China factory design cash acceptor robot arm vending machine with led display screen for fast food meals
$ -
>=1 Set
Meo Textile Clothing Co.LTD
Customize Drones Robots Pizza Vending Kiosk for Airport Bus Station
$ -
>=1 Unit
Meo Textile Clothing Co.LTD
fashion design pink vending machine with prepaid cards vending machine for retail items
$ -
>=1 Set
Meo Textile Clothing Co.LTD
AFEN hot popular cooling electronic locker vending machine for pharmacy products
$ 710 ~ $ 840
>=3 Set
Meo Textile Clothing Co.LTD
AFEN Refrigerated Locker Wireless 24 Hours Self Service Convenience Stores Cabinet Vending Machine
$ 750 ~ $ 927
>=3 Set
Meo Textile Clothing Co.LTD
AFEN 24 hours contactless coin and bill operated ppe vending machine with low price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
AFEN android touchscreen surgical facemask ppe hand sanitizer vending machine visa
$ -
>=1 Set
Meo Textile Clothing Co.LTD
AFEN 24 Hours automatic contactless surgical mask hand sanitizer gloves vending machine
$ 899
>=1 Set
Meo Textile Clothing Co.LTD
AFEN upgraded fresh food locker style vending machine with display screen
$ 750 ~ $ 927
>=3 Set
Meo Textile Clothing Co.LTD
AFEN 24 hour self service automatic pharmacy store medical locker vending machine
$ 710 ~ $ 840
>=3 Set
Meo Textile Clothing Co.LTD
American standard hot sale cosmetic vending machine with cheap price
$ -
>=1 Set
Meo Textile Clothing Co.LTD
24hours purchase pharmacy medical vending machine
$ -
>=1 Set
Meo Textile Clothing Co.LTD
new arrivals 2021 Vending Machine multi coin acceptor,Game machine multi coin acceptor
$ 15
>=30 Piece
Meo Electronic Technology Co.LTD
Self-service Wall Mount And Floor mount Automatic Vending Machine With Face Recognition And Advertising Player
$ 677 ~ $ 770
>=1 piec
Meo Textile Clothing Co.LTD
Related Searches:
icevendingmachinebusinesscafecoffeedayvendingmachinepricevintagevendingmechanicalvendingmachinenescafecoffeevendingmachinepricecommercialvendingmachine1950scokemachinecandyvendingmachinebusinesssilentsalesforcegumballmachinevendingmachinelocatorsvendingmachinesforsaleebayvendingsystemskittlesvendingmachineforsalevendingmachineplacementrunningavendingmachinebusinesshotmealvendingmachinevendingmachineshopusedsodavendingmachinesforsalenearmevendingsupplybubblegumvendingmachineminipopmachinepepsimachinesfooddispensermachineintelligentvendingmachinesmartvendingsolutionscakevendingmachinevendingshoplocalvendingmachinecompaniesvendingmachinebusinessforsalenearmeusedcokemachine