Welcome to TradeChina
-
RELATED CATEGORIES:
Tomato, Vinegar, Food Portland Organic Ketchup 14 oz Gluten Free Non GMO Vegan
$ 30
>=110 Unit
Meo Auto Parts Co.LTD
Japanese Boiled Instant Foods Noodles Vegan Health Japanese Food
$ 1.5 ~ $ 4
>=20 Piece
Meo Auto Parts Co.LTD
spicy vegan snacks vegetarian substitutes mala snack bulk Chinese food
$ 0.08 ~ $ 0.1
>=1 Pack
Meo Auto Parts Co.LTD
Japanese vegan food HALAL diet health food slim konjac food
$ 0.3 ~ $ 0.5
>=3000 Bag(s)
Meo Auto Parts Co.LTD
Customize causal konjac vegan snack food low calorie Konjac hot pot taste snack
$ 0.12 ~ $ 0.18
>=1 Bag(s)
Meo Auto Parts Co.LTD
Low carb konjak reis gluten free dry konjac rice vegan food
$ 0.7 ~ $ 1
>=1000 Bag(s)
Meo Auto Parts Co.LTD
Wholesale KOREA VEGAN FOOD Red TTEOK-BOKKI best food made in KOREA
$ 2.3 ~ $ 3.38
>=1 Piece
Meo Auto Parts Co.LTD
Gluten Free Keto Protein Bars Natural Ketogenic Toasted Coconut Vegan Low Carb Low Sugar
$ 2.98 ~ $ 4.25
>=300 Bag(s)
Meo Auto Parts Co.LTD
Frozen chicken nugget plant based meat vegan
$ 6 ~ $ 12
>=8000 Kilogram
Meo Auto Parts Co.LTD
Best Price Delicious Frozen Vegan Spring Roll For Fast Food 84 896674503
$ 10 ~ $ 45
>=20 Carton(s)
Meo Auto Parts Co.LTD
Vegan Snack Pumpkin Seeds and Sesame Seaweed Crisps
$ 0.5 ~ $ 1
>=7200 Bag(s)
Meo Auto Parts Co.LTD
Vinegar, Food, Bulk, Bib Organic Bulk Portland Ketchup 2.5 Gallon Bag-n-Box Non GMO
$ 30
>=80 Unit
Meo Auto Parts Co.LTD
Lifeworth coconut vegan keto protein bars chocolate
$ 4.3 ~ $ 5.8
>=50 Bag(s)
Meo Auto Parts Co.LTD
GMP HACCP Hot Selling 100% Organic Healthy Vegan Protein Vegetarian Diet Plant-forward Soy Bean Vegan Meat Sausage
$ 0.24 ~ $ 0.26
>=50000 piec
Meo Auto Parts Co.LTD
wholesale Chinese snacks spicy strip soybean products vegan meat
$ 3.4 ~ $ 3.56
>=500 Carton(s)
Meo Auto Parts Co.LTD
Soongan Anchovy Broth Vegan Made in Korea Food Natural freeze Drying Seafood Fish Soup Sauce Hot Soup Fish Seafood Dried Seafood
$ 3 ~ $ 16
>=100 Box(es)
Meo Auto Parts Co.LTD
Healthy Postum Cocoa Blend 7 Ounces Made Of Roasted Wheat And Molasses Kosher Nongmo Vegan
$ 6.25
>=2700 Unit
Meo Auto Parts Co.LTD
Italian Vegan Basil Pesto no cheese 195gr
$ 2.17 ~ $ 3.09
>=12 Piece
Meo Auto Parts Co.LTD
Processing konjac food japanese konjac konjac vegan for export
$ 1 ~ $ 24
>=1 Piece
Meo Auto Parts Co.LTD
Chinese Snack Vegan Food Instant Food Vegetable Curry Samosa 15g With Halal
$ 13 ~ $ 20
>=1000 Carton(s)
Meo Auto Parts Co.LTD
Low carb dry konjak nudeln gluten free dried shirataki konjac noodles vegan food
$ 2.3 ~ $ 2.5
>=1000 Bag(s)
Meo Auto Parts Co.LTD
KOREA VEGAN FOOD Red TTEOK-BOKKI best products made in KOREA
$ 2.3 ~ $ 3.38
>=1 Piece
Meo Auto Parts Co.LTD
TH Foods Honey Roasted Sesame Snack Sticks Ft 40 Lb. Bulk - Signature Recipe Made with Real Sesame and Honey. Great Crunch! USA
$ 1.66
>=1800 Pound
Meo Auto Parts Co.LTD
Halvah Tahini 100% Traditional Turkish Vegan Sesame Halva 500gr
$ 1.11 ~ $ 1.22
>=5000 Bag(s)
Meo Auto Parts Co.LTD
Supplier Good Taste Vegan Prawn With Vegetarian Shrimp 84 896674503
$ 0.11 ~ $ 0.16
>=50 Bag(s)
Meo Auto Parts Co.LTD
1 oz Amber & Rich Organic Maple Syrup By Maple Valley Cooperative 100% Vegan And Vegetarian Friendly
$ 1.85
>=96 Unit
Meo Auto Parts Co.LTD
private label top quality natural health immune booster powder to enhance immunity system diabetes daily vegan supplement
$ 8 ~ $ 15
>=10 Bag(s)
Meo Auto Parts Co.LTD
Vegan foodie UNCUT plant-based burger savory chicken
$ 20.54 ~ $ 22.54
>=480 Case(s)
Meo Auto Parts Co.LTD
Nature's PRIME Shreds Best Quality Plant-based Protein - All Natural, Vegan, Non-GMO Project Verified, Gluten Free, Low Fat
$ -
>=1 palette
Meo Auto Parts Co.LTD
Japan Wholesale Otafuku Tonkatsu Fried Food Vegan Products Sauce Dish
$ 1.8 ~ $ 2.3
>=120 Piece
Meo Auto Parts Co.LTD
Quality assurance konjac vegan food delicious tofu snack lower blood sugar organic chinese konjac tofu
$ 0.36 ~ $ 0.6
>=2 Carton(s)
Meo Auto Parts Co.LTD
Customized Japanese vegan food noodle organic konjac products
$ 2.1
>=1 Piece
Meo Auto Parts Co.LTD
Japanese hot sale potoes organic vegan frozen food products for sale
$ 2.9 ~ $ 111.27
>=72 Piece
Meo Auto Parts Co.LTD
keto food konjac noodles spicy chicken noodles instant shirataki noodles
$ 0.3 ~ $ 0.8
>=1000 Bag(s)
Meo Auto Parts Co.LTD
TH Foods Delicious Cajun Sesame Food Snack Sticks Ft 2 - 7.5 Lb. Bags - Goes Great as a Snack or with a Snack Mix! Great Crunch!
$ 1.51
>=1350 lb
Meo Auto Parts Co.LTD
Tahini Sesame Vegan 100% Natural Halal 300gr
$ 1.35 ~ $ 1.7
>=5000 Bag(s)
Meo Auto Parts Co.LTD
OEM organic buckwheat protein health meal replacement powder vegan cereal for diabetes Christmas gift
$ 5.5 ~ $ 8
>=96 Bag(s)
Meo Auto Parts Co.LTD
High Export Vegetarian Shrimp With Vegan Products In Vietnam 84 896674503
$ 0.11 ~ $ 0.16
>=50 Bag(s)
Meo Auto Parts Co.LTD
BEST KOREA VEGAN halal loose weight FOOD black TTEOK-BOKKI made in KOREA
$ 2.3 ~ $ 3.38
>=1 Piece
Meo Auto Parts Co.LTD
Nature's PRIME Mini Pieces Best Quality Plant-based Protein - All Natural, Vegan, Non-GMO Project Verified, Gluten Free, Low Fat
$ -
>=1 palette
Meo Auto Parts Co.LTD
Healthy Low Calories Hot Sale Vietname Salad Seasoning Vegan Food Fish Sauce
$ 7 ~ $ 7.5
>=300 Carton(s)
Meo Auto Parts Co.LTD
Sophisticated Organic Baked Pea Protein Crisps Kosher Vegan Herb 3.3 oz Offer New Twist On Beloved Favorite
$ 22.08 ~ $ 24.77
>=1 Case(s)
Meo Auto Parts Co.LTD
Organic Grain Beverage Tasty Coffee Flavored Postum 8 Ounces Made Of Roasted Wheat And Molasses Kosher Nongmo Vegan
$ 6.25
>=2700 Unit
Meo Auto Parts Co.LTD
Authentic Japanese Health Hot Plate Fried Sauce Products Vegan Food Seasoning
$ 2.6 ~ $ 3.1
>=120 Piece
Meo Auto Parts Co.LTD
The price of konjac vegan white konjac wet konjac has a light taste
$ 1 ~ $ 24
>=1 Piece
Meo Auto Parts Co.LTD
Worcestershire, Condiments, Sauce Portland Organic Worcestershire Sauce 8 oz Organic Vegan
$ 32
>=130 Unit
Meo Auto Parts Co.LTD
High dietary Chinese konjac vegan food
$ 0.12 ~ $ 0.18
>=1 Bag(s)
Meo Auto Parts Co.LTD
oem meal meat vegetarian spicy flavour healthy food ready to eat vegan
$ 0.08 ~ $ 0.1
>=1 Pack
Meo Auto Parts Co.LTD
No Bleaching Agent Food Grade Gluten Free Indonesia Origin Vegan UHT Coconut Milk
$ 1 ~ $ 2
>=18000 Liter
Meo Auto Parts Co.LTD
Low Fat Low Carb Konjac Snacks Chinese Instant Food Konjac Flour, Water Konjac Vegan Shrimp Salty,spicy 0.019 Kg Bag Packaging
$ 0.11 ~ $ 0.15
>=20 Bag(s)
Meo Auto Parts Co.LTD
Related Searches:
veganchocolatepowderveggieburgerwrapvegannuggetsvegetarianvitamind3cadburyveganchocolatemeatlessmeatsugarfreeveganproteinpowderb12foodsvegetarianglutenfreeveganbreadmacroveggieburgerstvpchickennuggetsvegetarianbbqburgershamburgervegetarianbestveggiepattyplantbasedveganproteinpowdervegetarianfoodtogainweightveganchickenpiecesveganramenpacketshealthyvegansweetsnacksvegansnackcakesveganyeastflakesveggieburgerproteinmeatlessoptionsnonmeatproteinveganskenuggetsveggiebunsvegansnacksonlinevegandietsplantbasedfoodcoloringveganbeyondmeatburgers